UniGene Name: sp_v3.0_unigene58140
Length: 225 nt
![]() |
---|
>sp_v3.0_unigene58140
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Ubiquitin carrier protein n=2 Tax=Picea sitchensis RepID=B8LMJ5_PICSI | - | - | 1.0e-26 | 94% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 94% |
Sma3 | Ubiquitin carrier protein | - | - | 1.14906e-43 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ligases, Forming carbon-nitrogen bonds, Acid--D-amino-acid ligases (peptide synthases). | EC:6.3.2.- | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Tryptophan metabolism | 00380 | 0.0 | % | |
Sma3 | Biosynthesis of siderophore group nonribosomal peptides | 01053 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | At2g18600; At4g36800; C7A10.560; E2; F24H14.5; GSVIVT00014673001; GSVIVT00024994001; LOC_Os10g11260; MICPUN_97701; OJ1742_G01.34; ORCE; Os08g0374100; Os09g0321900; Os10g0190000; OsI_29037; OsI_30867; OsJ_27106; OsJ_28851; OsJ_30936; Ot04g03440; P0690C12.2 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | small conjugating protein ligase activity | GO:0019787 | Molecular Function | 0.0 | - |
Sma3 | NEDD8 ligase activity | GO:0019788 | Molecular Function | 0.0 | - |
Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
Sma3 | embryo development | GO:0009790 | Biological Process | 0.0 | - |
Sma3 | modification-dependent protein catabolic process | GO:0019941 | Biological Process | 0.0 | - |
Sma3 | post-translational protein modification | GO:0043687 | Biological Process | 0.0 | - |
Sma3 | regulation of protein metabolic process | GO:0051246 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ubiquitin-conjugating enzyme, E2 | IPR000608 | - | 0.0 | - |
Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
Sma3 | IPR015580 | - | 0.0 | - | |
Sma3 | Ubiquitin-conjugating enzyme/RWD-like | IPR016135 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G36800.1 | RCE1 RUB1 conjugating enzyme 1 chr4:17341237-17342148 REVERSE LENGTH=184 | 3.0e-29 | 84% |
RefSeq | Arabidopsis thaliana | NP_001154289.1 | NEDD8-conjugating enzyme Ubc12 [Arabidopsis thaliana] | 4.0e-29 | 84% |
RefSeq | Populus trichocarpa | XP_002310200.1 | predicted protein [Populus trichocarpa] | 3.0e-29 | 84% |
![]() |
---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LMJ5
Fln msg: your sequence is shorter than subject: 63 - 183
Fln protein:
G
Protein Length:
64
Fln nts:
A
Fln Alignment:
F51TW9002GMV2Q___ILREDWKPVLNINTIIYGPNHLFTHPNHEDPLNHDAASVLRDNPRAFETNVRRAMAG
B8LMJ5_______________ILREDWKPVLNINTIIYGLNHLFSHPNHEDPLNHDAAAVLRDNPRAFETNVRRAMAG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain