|
||||||
|
UniGene Name: sp_v3.0_unigene57962
Length: 191 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene57962
A |
|
Ace file of the UniGene sp_v3.0_unigene57962 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Beta-galactosidase n=1 Tax=Raphanus sativus RepID=Q6L619_RAPSA | - | - | 3.0e-23 | 75% |
| FL-Next | sp=Beta-galactosidase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 72% |
| Sma3 | Beta-galactosidase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Beta-galactosidase. | EC:3.2.1.23 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Galactose metabolism | 00052 | 0.0 | % | |
| Sma3 | Other glycan degradation | 00511 | 0.0 | % | |
| Sma3 | Glycosaminoglycan degradation | 00531 | 0.0 | % | |
| Sma3 | Sphingolipid metabolism | 00600 | 0.0 | % | |
| Sma3 | Glycosphingolipid biosynthesis - ganglio series | 00604 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT5G56870; At1g31740; At1g45130; At2g28470; At2g32810; At3g13750; At3g52840; At4g26140; At4g36360; At5g20710; At5g56870; At5g63800; BG1; BGAL1; BGAL12; BGAL15; BGAL2; BGAL3; BGAL4; BGAL5; BGAL6; BGAL7; BGAL8; BGAL9; Bgal6; C7A10.1000; CARSR12; F20B18.250; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | beta-galactosidase complex | GO:0009341 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | beta-galactosidase activity | GO:0004565 | Molecular Function | 0.0 | - |
| Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
| Sma3 | cation binding | GO:0043169 | Molecular Function | 0.0 | - |
| Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
| Sma3 | plant-type cell wall modification | GO:0009827 | Biological Process | 0.0 | - |
| Sma3 | mucilage biosynthetic process involved in seed coat development | GO:0048354 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
| Sma3 | D-galactoside/L-rhamnose binding SUEL lectin domain | IPR000922 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 35 | IPR001944 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 2, N-terminal | IPR006104 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, subgroup, catalytic domain | IPR013781 | - | 0.0 | - |
| Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
| Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
| Sma3 | Peroxidases heam-ligand binding site | IPR019793 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G28470.1 | BGAL8 beta-galactosidase 8 chr2:12169047-12173164 REVERSE LENGTH=852 | 4.0e-29 | 73% |
| RefSeq | Arabidopsis thaliana | NP_001189624.1 | beta-galactosidase 8 [Arabidopsis thaliana] | 5.0e-29 | 73% |
| RefSeq | Populus trichocarpa | XP_002314274.1 | predicted protein [Populus trichocarpa] | 1.0e-28 | 73% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLU8
Fln msg: Distance to subject end: 693 aas, your sequence is shorter than subject: 63 - 836
Fln protein:
M
Protein Length:
64
Fln nts:
A
Fln Alignment:
F51TW9001DIM3D___PEKRRYNFEGRFDLVRFLKTVQEAGLYAHLRIGPYACAEWNYGGLPVWLHSIPGIALRTDN
B8LLU8_______________PSPGNYNFEGRFDLVKFVKLAQEAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDN
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
