UniGene Name: sp_v3.0_unigene57846
Length: 162 nt
![]() |
---|
>sp_v3.0_unigene57846
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Laccase n=3 Tax=Pinus RepID=F4MKL7_PINPS | - | - | 4.0e-22 | 95% |
FL-Next | tr=Laccase; Pinus taeda (Loblolly pine). | - | - | 0.0 | 97% |
Sma3 | Laccase | - | - | 4.65e-40 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Laccase. | EC:1.10.3.2 | - | 0.0 | - |
Sma3 | L-ascorbate oxidase. | EC:1.10.3.3 | - | 4.242e-31 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ascorbate and aldarate metabolism | 00053 | 4.242e-31 | % | |
Sma3 | Metabolic pathways | 01100 | 4.242e-31 | % |
Source | Gene names |
---|---|
Sma3 | At2g29130; At2g30210; At2g38080; At2g40370; At3g09220; At5g01190; At5g03260; At5g05390; At5g07130; At5g58910; At5g60020; B1026C12.14; B1088C09.5; F15A17_290; F16M14.1; F3L24.9; F7J8.170; GLac3; GLac90; GSVIVT00001780001; GSVIVT00001781001; GSVIVT000063730 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | copper ion binding | GO:0005507 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | laccase activity | GO:0008471 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
Sma3 | secondary cell wall biogenesis | GO:0009834 | Biological Process | 0.0 | - |
Sma3 | lignin catabolic process | GO:0046274 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
Sma3 | Multicopper oxidase, type 1 | IPR001117 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Multicopper oxidase, copper-binding site | IPR002355 | - | 0.0 | - |
Sma3 | Cupredoxin | IPR008972 | - | 0.0 | - |
Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
Sma3 | Multicopper oxidase, type 2 | IPR011706 | - | 0.0 | - |
Sma3 | Multicopper oxidase, type 3 | IPR011707 | - | 0.0 | - |
Sma3 | Laccase | IPR017761 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 1, active site | IPR018120 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G05390.1 | LAC12 laccase 12 chr5:1594753-1597042 FORWARD LENGTH=565 | 5.0e-25 | 85% |
RefSeq | Arabidopsis thaliana | NP_196158.1 | laccase 12 [Arabidopsis thaliana] | 7.0e-25 | 85% |
RefSeq | Populus trichocarpa | XP_002312186.1 | laccase 90a [Populus trichocarpa] | 4.0e-25 | 87% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q9AUI5
Fln msg: Distance to subject end: 414 aas, your sequence is shorter than subject: 53 - 576
Fln protein:
T
Protein Length:
54
Fln nts:
T
Fln Alignment:
F5X2MQL01AN7RL___TQCPIRPGRSYTYKFTITGQEGTLWWHAHSSWLRATVYGALIILPRLGT
Q9AUI5_______________TQCPIRPGRSYTYKFTITGQEGTLWWHAHSSWLRATVYGALIILPRLDT
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain