|
||||||
|
UniGene Name: sp_v3.0_unigene57685
Length: 243 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene57685
A |
|
Ace file of the UniGene sp_v3.0_unigene57685
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Os05g0585500 protein n=2 Tax=Oryza sativa Japonica Group RepID=Q6I587_ORYSJ | - | - | 2.0e-25 | 66% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 57% |
| Sma3 | Calcium-dependent protein kinase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Non-specific serine/threonine protein kinase. | EC:2.7.11.1 | - | 0.0 | - |
| Sma3 | Calcium/calmodulin-dependent protein kinase. | EC:2.7.11.17 | - | 3.12e-23 | - |
| Source | Gene names |
|---|---|
| Sma3 | 6J23.10; AK1; ATEM1.10; At1g50700; At1g61950; At1g76040; At2g17290; At2g31500; At2g38910; At2g41860; At3g10660; At3g20410; At3g51850; At3g57530; At4g04720; At4g09570; At4g21940; At4g23650; At4g35310; At4g38230; At5g04870; At5g12180; At5g19360; At5g23580; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | peroxisomal membrane | GO:0005778 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum membrane | GO:0005789 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | calcium-dependent protein kinase C activity | GO:0004698 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | abscisic acid mediated signaling pathway | GO:0009738 | Biological Process | 0.0 | - |
| Sma3 | positive regulation of abscisic acid mediated signaling pathway | GO:0009789 | Biological Process | 0.0 | - |
| Sma3 | regulation of stomatal movement | GO:0010119 | Biological Process | 0.0 | - |
| Sma3 | regulation of anion channel activity | GO:0010359 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ribosomal protein S16 | IPR000307 | - | 0.0 | - |
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Calcium-binding EF-hand | IPR002048 | - | 0.0 | - |
| Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | EF-hand-like domain | IPR011992 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Sma3 | EF-hand | IPR018248 | - | 0.0 | - |
| Sma3 | EF-HAND 2 | IPR018249 | - | 0.0 | - |
| Sma3 | ATPase, P-type phosphorylation site | IPR018303 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G61950.1 | CPK19 calcium-dependent protein kinase 19 chr1:22899417-22901941 FORWARD LENGTH=551 | 1.0e-30 | 64% |
| RefSeq | Arabidopsis thaliana | NP_176386.2 | calcium-dependent protein kinase 19 [Arabidopsis thaliana] | 2.0e-30 | 64% |
| RefSeq | Populus trichocarpa | XP_002298000.1 | calcium dependent protein kinase 3 [Populus trichocarpa] | 3.0e-31 | 66% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PQ38
Fln msg: Distance to subject end: 214 aas, your sequence is shorter than subject: 81 - 529
Fln protein:
M
Protein Length:
82
Fln nts:
A
Fln Alignment:
F5X2MQL01AT5VT___SAGVILYILLSGTPPFWAKTERDLLKAILHGNIDFDREPWPSISSGAKDLIKNMLKREAKERITSSQVLDHPWMR
C0PQ38_______________SAGVILYILLCGVPPFWAESEQGVAQAILRGFVDFKREPWPKISETAKSLVRQMLEPDPKRRLTAQQVIEHPWLQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
