UniGene Name: sp_v3.0_unigene57679
Length: 232 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene57679
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Pol protein integrase region (Fragment) n=6 Tax=Spermatophyta RepID=Q9M6N3_9CONI | - | - | 2.0e-25 | 96% |
FL-Next | tr=Putative retroelement pol polyprotein; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 61% |
Sma3 | Pol protein integrase region | - | - | 0.0 | - |
Source | Gene names |
---|---|
Sma3 | At2g14640; F23H6.1; H0321H01.8; H0502G05.7; LOC_Os03g05340; LOC_Os03g09990; LOC_Os03g30360; LOC_Os03g47870; LOC_Os10g28310; LOC_Os10g40400; LOC_Os10g40890; LOC_Os10g42880; LOC_Os11g06400; LOC_Os11g08610; LOC_Os11g26820; LOC_Os11g30840; LOC_Os11g31050; LOC |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | transporter activity | GO:0005215 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding | GO:0043565 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | apoptotic process | GO:0006915 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
![]() |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: Q9SQW9
Fln msg: Distance to subject end: 240 aas, your sequence is shorter than subject: 77 - 1661
Fln protein:
T
Protein Length:
78
Fln nts:
A
Fln Alignment:
F5X2MQL01EPRSK___TELFSCLGTQLAHSSSYHPQSDGQTEIVNKCLEGYLRCFVSDKQTQWIKWLPLAEWWYNTSFHTAKKMTPFMALYG
Q9SQW9_______________SELFKLQGTGLQKSTAYHPQTDGQTEVVNRCLESYLRCFAGRRPTSWFQWLPWAEYWYNTSYHSATKTTPFQAVYG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain