|
||||||
|
UniGene Name: sp_v3.0_unigene56991
Length: 211 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene56991
T |
|
Ace file of the UniGene sp_v3.0_unigene56991
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | CMCase; cellulase; endo-1,4-beta-D-glucanase [Glycine max] | - | - | 2.0e-17 | 66% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 65% |
| Sma3 | Endo-1,4-beta-glucanase | - | - | 4.199e-18 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cellulase. | EC:3.2.1.4 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Starch and sucrose metabolism | 00500 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | Al-cel1; At1g02800; At1g22880; At1g23210; At1g70710; At2g44550; At2g44570; At4g02290; At4g39010; B1011A07.26; CEL1; CEL2; CEL5; Cel1; Cel2; Cel7; Cel9; EG3; EGL1; EGL2; F16B22.6; F19G10.16; F19H22.110; F22D16.21; F26F24.6; F4I1.55; F5A18.11; GLU12; GLU13; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | hydrolase activity, hydrolyzing O-glycosyl compounds | GO:0004553 | Molecular Function | 0.0 | - |
| Sma3 | cellulase activity | GO:0008810 | Molecular Function | 0.0 | - |
| Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
| Sma3 | cellular cell wall organization | GO:0007047 | Biological Process | 0.0 | - |
| Sma3 | pattern specification process | GO:0007389 | Biological Process | 0.0 | - |
| Sma3 | response to nematode | GO:0009624 | Biological Process | 0.0 | - |
| Sma3 | fruit ripening | GO:0009835 | Biological Process | 0.0 | - |
| Sma3 | cellulose catabolic process | GO:0030245 | Biological Process | 0.0 | - |
| Sma3 | cell wall modification involved in multidimensional cell growth | GO:0042547 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycoside hydrolase, family 9 | IPR001701 | - | 0.0 | - |
| Sma3 | Six-hairpin glycosidase | IPR012341 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 9, active site | IPR018221 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G39010.1 | AtGH9B18, GH9B18 glycosyl hydrolase 9B18 chr4:18176162-18179102 REVERSE LENGTH=497 | 3.0e-22 | 68% |
| RefSeq | Arabidopsis thaliana | NP_568050.1 | endoglucanase 24 [Arabidopsis thaliana] | 4.0e-22 | 68% |
| RefSeq | Populus trichocarpa | XP_002321833.1 | predicted protein [Populus trichocarpa] | 6.0e-21 | 63% |
| Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NUH0
Fln msg: your sequence is shorter than subject: 65 - 514
Fln protein:
Y
Protein Length:
66
Fln nts:
T
Fln Alignment:
F51TW9002GDCG3___SSPNPNLLVGAVVGGPDQNDQYDDVRSAFKQSEPTTYINAPRVGVLAYFSAHPNY
A9NUH0_______________NAPNPNRLVGAVVGGPDNNDRFSDERNDYAHSEPTTYINAPLVGSLAYL-AHSSY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
