UniGene Name: sp_v3.0_unigene56525
Length: 229 nt
UniGene Fasta |
---|
>sp_v3.0_unigene56525
T |
Ace file of the UniGene sp_v3.0_unigene56525 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp|Q9M2Y7.1|PP274_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g49710 emb|CAB66909.1| putative protein [Arabidopsis thaliana] gb|AEE78579.1| pentatricopeptide repeat- | - | - | 1.0e-16 | 63% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 67% |
Sma3 | Putative pentatricopeptide (PPR) repeat-containing protein | - | - | 1.709e-07 | - |
Source | Gene names |
---|---|
Sma3 | At1g17630; At2g01510; At3g16610; At3g49140; At3g49710; At4g30700; DYW9; F1L3.33; F2I9.13; F2K15.2; GSVIVT00000117001; GSVIVT00000138001; GSVIVT00000282001; GSVIVT00000887001; GSVIVT00001706001; GSVIVT00002188001; GSVIVT00002423001; GSVIVT00006467001; GSVI |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | mitosis | GO:0007067 | Biological Process | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Armadillo | IPR000225 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
Sma3 | Adenosine/AMP deaminase domain | IPR001365 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | DNA-binding HORMA | IPR003511 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF659 | IPR007021 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | IPR011523 | - | 0.0 | - | |
Sma3 | Armadillo-like helical | IPR011989 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | Methyltransferase type 11 | IPR013216 | - | 0.0 | - |
Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Thioredoxin, conserved site | IPR017937 | - | 0.0 | - |
Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G49710.1 | Pentatricopeptide repeat (PPR) superfamily protein chr3:18437845-18440010 FORWARD LENGTH=721 | 1.0e-21 | 63% |
RefSeq | Arabidopsis thaliana | NP_190540.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 2.0e-21 | 63% |
RefSeq | Populus trichocarpa | XP_002302824.1 | predicted protein [Populus trichocarpa] | 1.0e-24 | 64% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ADG9
Fln msg: Distance to subject end: 201 aas, your sequence is shorter than subject: 76 - 312
Fln protein:
F
Protein Length:
77
Fln nts:
T
Fln Alignment:
F51TW9001EEB3M___LHVLSTCSHAGLVVEGWEIFNCMRESFHITPRAEHYACMVDLLGRAGQLDEAEKFIQDMPIEPSSSV
D5ADG9_______________ISVLSACSHAGLVDEGWKCYNCMTLDYAITPTVEHYACMVDLLGRAGHLNEAWDFIEKMPIEPGASV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain