|
||||||
|
UniGene Name: sp_v3.0_unigene56302
Length: 184 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene56302
A |
|
Ace file of the UniGene sp_v3.0_unigene56302
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Unassigned protein | - | - | 1.0e-17 | 65% |
| FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 65% |
| Source | Gene names |
|---|---|
| Sma3 | GSVIVT00000833001; GSVIVT00004937001; GSVIVT00005459001; GSVIVT00005481001; GSVIVT00005536001; GSVIVT00005553001; GSVIVT00005910001; GSVIVT00006840001; GSVIVT00006929001; GSVIVT00008081001; GSVIVT00009068001; GSVIVT00009118001; GSVIVT00011391001; GSVIVT00 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chromosome | GO:0005694 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | DNA topoisomerase type I activity | GO:0003917 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
| Sma3 | DNA topological change | GO:0006265 | Biological Process | 0.0 | - |
| Sma3 | DNA unwinding involved in replication | GO:0006268 | Biological Process | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | fatty acid biosynthetic process | GO:0006633 | Biological Process | 0.0 | - |
| Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: A5AE03
Fln msg: Distance to subject end: 775 aas, your sequence is shorter than subject: 61 - 1779
Fln protein:
W
Protein Length:
62
Fln nts:
A
Fln Alignment:
F51TW9001CEZ2T___VCTHRIYIKEGCRPVCQPQRRMNPNLREIVKEELQKLLNAGFIYPISDSEWVSPLVIVPK
A5AE03_______________VCTHHIYMEEEAKPICQPQRRLNPHLQEVVRAEVLKLLQAGIIYPISDSPWVSPTQVVPK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
