SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene55571

Length: 321 nt

UniGene Fasta

>sp_v3.0_unigene55571
ATGGGGTAGTTGAATGTGAGGTGTGTCAATGCCACAAAGGAGAAACAATCAAATTACCAGGCACCTTACAACCATTGCCAATCCCTGCCTTCGTCTGGACGGATGTTTCTCTGGATTTCATTACTAATCTCCCGAAGTCAGGCAACAAATCAATCATCATGGTGGTAGTGGACAAACTTTCTAAATATGCTCATTTTTGCGCTCCACCCCATCCATTTACCCCCACTTTGGTGGCTCAAGATTTCATTGACCAGATCTTCAAACTGCATGGCATGCCAACAACTTCCATTGTGTTTGATCGTGATCTGACTTTCACCAGTA

Ace file of the UniGene sp_v3.0_unigene55571

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Polyprotein (Fragment) n=1 Tax=Ananas comosus RepID=B4YF15_ANACO	-	-	8.0e-28	60%
FL-Next	tr=Putative uncharacterized protein; Vitis vinifera (Grape).	-	-	0.0	60%
Sma3	Retrotransposon protein, putative, unclassified	-	-	3.442e-33	-

Source	Gene names
Sma3	At2g05610; F23H6.1; H0321H01.8; H0502G05.7; LOC_Os03g05340; LOC_Os03g05350; LOC_Os03g06100; LOC_Os03g13350; LOC_Os03g29864; LOC_Os03g47840; LOC_Os03g47870; LOC_Os10g09370; LOC_Os10g16880; LOC_Os10g28310; LOC_Os10g37620; LOC_Os10g40400; LOC_Os10g40890; LOC

Source	GOs	Term	Type	Identity
Sma3	chromatin	GO:0000785	Cellular Component	-
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	ribosome	GO:0005840	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	chromatin binding	GO:0003682	Molecular Function	-
Sma3	sequence-specific DNA binding transcription factor activity	GO:0003700	Molecular Function	-
Sma3	RNA binding	GO:0003723	Molecular Function	-
Sma3	structural constituent of ribosome	GO:0003735	Molecular Function	-
Sma3	RNA-directed DNA polymerase activity	GO:0003964	Molecular Function	-
Sma3	aspartic-type endopeptidase activity	GO:0004190	Molecular Function	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	transporter activity	GO:0005215	Molecular Function	-
Sma3	SNAP receptor activity	GO:0005484	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	sugar binding	GO:0005529	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	sequence-specific DNA binding	GO:0043565	Molecular Function	-
Sma3	metal ion transmembrane transporter activity	GO:0046873	Molecular Function	-
Sma3	RNA-dependent DNA replication	GO:0006278	Biological Process	-
Sma3	chromatin assembly or disassembly	GO:0006333	Biological Process	-
Sma3	regulation of transcription, DNA-dependent	GO:0006355	Biological Process	-
Sma3	translation	GO:0006412	Biological Process	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	proteolysis	GO:0006508	Biological Process	-
Sma3	transport	GO:0006810	Biological Process	-
Sma3	intracellular protein transport	GO:0006886	Biological Process	-
Sma3	apoptotic process	GO:0006915	Biological Process	-
Sma3	DNA integration	GO:0015074	Biological Process	-
Sma3	vesicle-mediated transport	GO:0016192	Biological Process	-
Sma3	metal ion transport	GO:0030001	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Reverse transcriptase	IPR000477	-	-
Sma3	Ribosomal protein S15	IPR000589	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Target SNARE coiled-coil domain	IPR000727	-	-
Sma3	Chromo domain/shadow	IPR000953	-	-
Sma3	Legume lectin, alpha chain, conserved site	IPR000985	-	-
Sma3	Legume lectin domain	IPR001220	-	-
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	F-box domain, cyclin-like	IPR001810	-	-
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	Protein translocase complex, SecE/Sec61-gamma subunit	IPR001901	-	-
Sma3	Peptidase aspartic, active site	IPR001969	-	-
Sma3	NB-ARC	IPR002182	-	-
Sma3	DNA-binding WRKY	IPR003657	-	-
Sma3	Zinc/iron permease	IPR003689	-	-
Sma3	Retrotransposon gag protein	IPR005162	-	-
Sma3	General substrate transporter	IPR005828	-	-
Sma3	Syntaxin, N-terminal	IPR006011	-	-
Sma3	Syntaxin/epimorphin, conserved site	IPR006012	-	-
Sma3	Protein of unknown function DUF594	IPR007658	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	Domain of unknown function DUF834	IPR008552	-	-
Sma3	S15/NS1, RNA-binding	IPR009068	-	-
Sma3	Reverse transcriptase, RNA-dependent DNA polymerase	IPR013103	-	-
Sma3	Retroviral aspartyl protease	IPR013242	-	-
Sma3	Concanavalin A-like lectin/glucanase, subgroup	IPR013320	-	-
Sma3	Zinc finger, H2C2-type, histone UAS binding	IPR015416	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: tr_plants

Fln subject: A5BEK1

Fln msg: Distance to subject end: 278 aas, your sequence is shorter than subject: 106 - 1469

Fln protein: GVVECEVCQCHKGETIKLPGTLQPLPIPAFVWTDVSLDFITNLPKSGNKSIIMVVVDKLSKYAHFCAPPHPFTPTLVAQDFIDQIFKLHGMPTTSIVFDRDLTFTS

Protein Length: 107

Fln nts: ATGGGGTAGTTGAATGTGAGGTGTGTCAATGCCACAAAGGAGAAACAATCAAATTACCAGGCACCTTACAACCATTGCCAATCCCTGCCTTCGTCTGGACGGATGTTTCTCTGGATTTCATTACTAATCTCCCGAAGTCAGGCAACAAATCAATCATCATGGTGGTAGTGGACAAACTTTCTAAATATGCTCATTTTTGCGCTCCACCCCATCCATTTACCCCCACTTTGGTGGCTCAAGATTTCATTGACCAGATCTTCAAACTGCATGGCATGCCAACAACTTCCATTGTGTTTGATCGTGATCTGACTTTCACCAGTA

Fln Alignment:

F585NNT02IUOTQ___VVECEVCQCHKGETIKLPGTLQPLPIPAFVWTDVSLDFITNLPKSGNKSIIMVVVDKLSKYAHFCAPPHPFTPTLVAQDFIDQIFKLHGMPTTSIVFDRDLTFTS
A5BEK1_______________IKECDICQQNKSENIHPAGLLQPLPIPTKVWTDISLDFIEGLPNSESYSVIMVVVDRLSKYAHFIPISHPYTASKIAQVFLANIFKLHGLP-NSIVTDRDPTFTS

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain