|
||||||
|
UniGene Name: sp_v3.0_unigene54649
Length: 239 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene54649
G |
|
Ace file of the UniGene sp_v3.0_unigene54649 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | pfam01535, PPR, PPR repeat | - | - | 4.0e-05 | 37% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 55% |
| Sma3 | Pentatricopeptide repeat-containing protein, putative | - | - | 3.294e-14 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g11290; At3g26782; At3g49140; At4g18750; At4g39952; B1358B12.23; F28A21.160; F2K15.2; GSVIVT00001706001; GSVIVT00004068001; GSVIVT00006467001; GSVIVT00008457001; GSVIVT00010543001; GSVIVT00011422001; GSVIVT00014110001; GSVIVT00016225001; GSVIVT00017181 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | nuclease activity | GO:0004518 | Molecular Function | 0.0 | - |
| Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | nucleotide-excision repair | GO:0006289 | Biological Process | 0.0 | - |
| Sma3 | phloem or xylem histogenesis | GO:0010087 | Biological Process | 0.0 | - |
| Sma3 | leaf vascular tissue pattern formation | GO:0010305 | Biological Process | 0.0 | - |
| Sma3 | cotyledon vascular tissue pattern formation | GO:0010588 | Biological Process | 0.0 | - |
| Sma3 | mRNA modification | GO:0016556 | Biological Process | 0.0 | - |
| Sma3 | leaf development | GO:0048366 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Legume lectin domain | IPR001220 | - | 0.0 | - |
| Sma3 | Kinesin, motor domain | IPR001752 | - | 0.0 | - |
| Sma3 | F-box domain, cyclin-like | IPR001810 | - | 0.0 | - |
| Sma3 | UVR domain | IPR001943 | - | 0.0 | - |
| Sma3 | Calcium-binding EF-hand | IPR002048 | - | 0.0 | - |
| Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
| Sma3 | JmjC domain | IPR003347 | - | 0.0 | - |
| Sma3 | Hemimethylated DNA-binding domain | IPR011722 | - | 0.0 | - |
| Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
| Sma3 | EF-hand-like domain | IPR011992 | - | 0.0 | - |
| Sma3 | IPR013129 | - | 0.0 | - | |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Sma3 | EF-hand | IPR018248 | - | 0.0 | - |
| Sma3 | EF-HAND 2 | IPR018249 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G18750.1 | DOT4 Pentatricopeptide repeat (PPR) superfamily protein chr4:10304850-10307465 FORWARD LENGTH=871 | 5.0e-26 | 54% |
| RefSeq | Arabidopsis thaliana | NP_193610.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 6.0e-26 | 54% |
| RefSeq | Populus trichocarpa | XP_002309359.1 | predicted protein [Populus trichocarpa] | 8.0e-29 | 59% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQA8
Fln msg: Distance to subject end: 254 aas, your sequence is shorter than subject: 79 - 795
Fln protein:
V
Protein Length:
80
Fln nts:
G
Fln Alignment:
F51TW9002I6C6K___VVTALIDMYARCGSVEIARQLFDNMPIRDAVTWTVMVAGYGMHGHGEDAIALFSQMRHTKMKPNRITFISVLSACSHAG
B8LQA8_______________VGTGLVDIYAKCGNVNTAQKLFERMPEQDVVSWTTMILAYGIHGHGEDALALFSKMQETGTKLDHIAFTAILTACSHAG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
