UniGene Name: sp_v3.0_unigene54605
Length: 235 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene54605
G |
Ace file of the UniGene sp_v3.0_unigene54605 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Cinnamyl alcohol dehydrogenase-like protein n=2 Tax=Populus RepID=B9IIG5_POPTR | - | - | 7.0e-18 | 58% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 63% |
Sma3 | Cinnamyl alcohol dehydrogenase-like protein | - | - | 4.843e-22 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cinnamyl-alcohol dehydrogenase. | EC:1.1.1.195 | - | 9.319e-10 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phenylpropanoid biosynthesis | 00940 | 9.319e-10 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 9.319e-10 | % | |
Sma3 | Metabolic pathways | 01100 | 9.319e-10 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 9.319e-10 | % | |
Sma3 | Mannitol dehydrogenase. | EC:1.1.1.255 | - | 5.611e-37 | - |
Source | Gene names |
---|---|
Sma3 | AT4G37980; At4g37980; CAD; CAD1; CAD7; CADL1; CADL10; CADL3; CADL4; CADL6; CADL7; CADL8; CADL9; ELI3; ELI3-1; Eli3; F20D10.100; GEDH1; GSVIVT00008719001; GSVIVT00011479001; GSVIVT00011482001; GSVIVT00011484001; GSVIVT00011638001; GSVIVT00011639001; GSVIVT |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | cinnamyl-alcohol dehydrogenase activity | GO:0045551 | Molecular Function | 0.0 | - |
Sma3 | mannitol dehydrogenase activity | GO:0046029 | Molecular Function | 0.0 | - |
Sma3 | response to bacterium | GO:0009617 | Biological Process | 0.0 | - |
Sma3 | lignin biosynthetic process | GO:0009809 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Alcohol dehydrogenase superfamily, zinc-type | IPR002085 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase, zinc-type, conserved site | IPR002328 | - | 0.0 | - |
Sma3 | D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding | IPR006140 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase, C-terminal | IPR013149 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase GroES-like | IPR013154 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G39330.1 | ATCAD9, CAD9 cinnamyl alcohol dehydrogenase 9 chr4:18291268-18292772 FORWARD LENGTH=360 | 4.0e-22 | 54% |
RefSeq | Arabidopsis thaliana | NP_195643.1 | putative cinnamyl alcohol dehydrogenase 9 [Arabidopsis thaliana] | 6.0e-22 | 54% |
RefSeq | Populus trichocarpa | XP_002322761.1 | cinnamyl alcohol dehydrogenase-like protein [Populus trichocarpa] | 6.0e-24 | 58% |
Full-Lengther Next Prediction |
---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NQK7
Fln msg: query STOP codon is far from subject stop. Distance to subject end: 16 aas, your sequence is shorter than subject: 69 - 166
Fln protein:
V
Protein Length:
70
Fln nts:
G
Fln Alignment:
F51TW9002GPJKR___VPPEPMSIPTFPLLAGRLSIGGSMIGGIKETQEMLDFCGKHDVVCKCEVIPMQYVNTALERLVKNDVK
A9NQK7_______________MPEKPLSLPSVALAAGRRFVGGSAIGGVKETQEMLDFCGKHGISCMIENIPIDYVNTAMERLGKGDVK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain