|
||||||
|
UniGene Name: sp_v3.0_unigene54121
Length: 196 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene54121
T |
|
Ace file of the UniGene sp_v3.0_unigene54121
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Unassigned protein | - | - | 0.0 | - |
| FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 58% |
| Sma3 | Retrotransposon protein, putative, unclassified | - | - | 5.101e-11 | - |
| Source | Gene names |
|---|---|
| Sma3 | H0321H01.8; LOC_Os03g05340; LOC_Os03g61190; LOC_Os10g40400; LOC_Os11g06400; LOC_Os11g29180; LOC_Os11g30650; LOC_Os11g35200; LOC_Os11g45200; LOC_Os11g45920; LOC_Os12g18080; LOC_Os12g24050; LOC_Os12g43850; MtrDRAFT_AC150244g37v2; OJ1111_B11.1; OSJNBa0004B23 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
| Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
| Sma3 | triglyceride lipase activity | GO:0004806 | Molecular Function | 0.0 | - |
| Sma3 | transporter activity | GO:0005215 | Molecular Function | 0.0 | - |
| Sma3 | SNAP receptor activity | GO:0005484 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | sequence-specific DNA binding | GO:0043565 | Molecular Function | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | lipid metabolic process | GO:0006629 | Biological Process | 0.0 | - |
| Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
| Sma3 | intracellular protein transport | GO:0006886 | Biological Process | 0.0 | - |
| Sma3 | apoptotic process | GO:0006915 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Sma3 | vesicle-mediated transport | GO:0016192 | Biological Process | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: A5AP28
Fln msg: Distance to subject end: 560 aas, your sequence is shorter than subject: 65 - 647
Fln protein:
S
Protein Length:
66
Fln nts:
T
Fln Alignment:
F5X2MQL01BZFYM___SGTGIGAVLMQEGRPLAFTSQQLSGRNLGQSTYEKEMMAILHAVETWRPYLLGRRFQIRTDHHNL
A5AP28_______________SGDGIGAVLTQQGKPVAFMSRALGVSELSWSTYAKEMLAIIHAIRTWRPYLLGQKFYIQTNQRSL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
