SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene54046

Length: 302 nt

UniGene Fasta

>sp_v3.0_unigene54046
ATGGGGGGAGAAATCAAGAAGTGGTCTCTGGAAGATATAAGCTACTGGTTGAGGTTTGTGGCATCGATTAGGTTATAGATAATGGGTAGATCTCCTGGTTGTTGGAGATATTCAAAACATGAGGAGGGTCTCAAACACGGGGCTTGGACACCTAGCGAAGACAAGATTTTGATTGAATACATTAACACTCATGGCATTGGTCGATGGAGAGATCTTCCACGGAAAGCAGGTCTCAGACGATGTGTGAAGAGCTGTAGATTGCGTTGGTTGAACTATCTTCGTCCAGATATTAAGCGCGGAAA

Ace file of the UniGene sp_v3.0_unigene54046

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	MYB transcription factor [Arabidopsis thaliana]	-	-	3.0e-22	67%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	69%
Sma3	MYB transcription factor	-	-	2.412e-29	-

Source	Gene names
Sma3	ATR1; At1g18570; At1g18570/F25I16_4; At1g22640; At1g34670; At1g74080; At2g16720; At2g31180; At3g01140; At3g02940; At3g23250; At4g05100; At4g21440; At4g28110; At5g07690; At5g07700; At5g15310; At5g16770; At5g54230; At5g54230/MDK4.5; At5g60890; At5g61420; At

Source	GOs	Term	Type	Identity
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	sequence-specific DNA binding transcription factor activity	GO:0003700	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	transcription activator activity	GO:0016563	Molecular Function	-
Sma3	tryptophan biosynthetic process	GO:0000162	Biological Process	-
Sma3	cell morphogenesis	GO:0000902	Biological Process	-
Sma3	defense response to insect	GO:0002213	Biological Process	-
Sma3	regulation of transcription, DNA-dependent	GO:0006355	Biological Process	-
Sma3	response to stress	GO:0006950	Biological Process	-
Sma3	response to wounding	GO:0009611	Biological Process	-
Sma3	response to salt stress	GO:0009651	Biological Process	-
Sma3	response to ethylene stimulus	GO:0009723	Biological Process	-
Sma3	response to auxin stimulus	GO:0009733	Biological Process	-
Sma3	response to abscisic acid stimulus	GO:0009737	Biological Process	-
Sma3	response to gibberellin stimulus	GO:0009739	Biological Process	-
Sma3	response to salicylic acid stimulus	GO:0009751	Biological Process	-
Sma3	response to jasmonic acid stimulus	GO:0009753	Biological Process	-
Sma3	indole glucosinolate biosynthetic process	GO:0009759	Biological Process	-
Sma3	cinnamic acid biosynthetic process	GO:0009800	Biological Process	-
Sma3	negative regulation of metabolic process	GO:0009892	Biological Process	-
Sma3	response to chitin	GO:0010200	Biological Process	-
Sma3	cellular response to sulfur starvation	GO:0010438	Biological Process	-
Sma3	regulation of glucosinolate biosynthetic process	GO:0010439	Biological Process	-
Sma3	cell growth	GO:0016049	Biological Process	-
Sma3	cuticle development	GO:0042335	Biological Process	-
Sma3		GO:0045449	Biological Process	-
Sma3	response to cadmium ion	GO:0046686	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	SANT/Myb domain	IPR001005	-	-
Sma3	DNA methylase, N-6 adenine-specific, conserved site	IPR002052	-	-
Sma3		IPR012287	-	-
Sma3		IPR014778	-	-
Sma3	Myb transcription factor	IPR015495	-	-
Sma3	Myb-like domain	IPR017877	-	-
Sma3	Myb domain, DNA-binding	IPR017930	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT4G05100.1	AtMYB74, MYB74 myb domain protein 74 chr4:2618557-2619790 FORWARD LENGTH=324	1.0e-28	67%
RefSeq	Arabidopsis thaliana	NP_192419.1	myb domain protein 74 [Arabidopsis thaliana]	1.0e-28	67%
RefSeq	Populus trichocarpa	XP_002308528.1	predicted protein [Populus trichocarpa]	4.0e-29	68%

Full-Lengther Next Prediction

Fln status: N-terminus

Fln database: coniferopsida.fasta

Fln subject: B8LMJ6

Fln msg: Distance to subject end: 323 aas, your sequence is shorter than subject: 73 - 392

Fln protein: MGRSPGCWRYSKHEEGLKHGAWTPSEDKILIEYINTHGIGRWRDLPRKAGLRRCVKSCRLRWLNYLRPDIKRG

Protein Length: 74

Fln nts: ATGGGGGGAGAAATCAAGAAGTGGTCTCTGGAAGATATAAGCTACTGGTTGAGGTTTGTGGCATCGATTAGGTTATAGATA_-_ATGGGTAGATCTCCTGGTTGTTGGAGATATTCAAAACATGAGGAGGGTCTCAAACACGGGGCTTGGACACCTAGCGAAGACAAGATTTTGATTGAATACATTAACACTCATGGCATTGGTCGATGGAGAGATCTTCCACGGAAAGCAGGTCTCAGACGATGTGTGAAGAGCTGTAGATTGCGTTGGTTGAACTATCTTCGTCCAGATATTAAGCGCGGAAA

Fln Alignment:

F5X2MQL01DAVVJ___MGRSPGCWRYSKHEEGLKHGAWTPSEDKILIEYINTHGIGRWRDLPRKAGLRRCVKSCRLRWLNYLRPDIKRG
B8LMJ6_______________MGRSPCC-----SKEGLNRGAWTKKEDMILSEYIRIHGDGGWRNLPKKAGLKRCGKSCRLRWLNYLRPDIKRG

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain