UniGene Name: sp_v3.0_unigene54028
Length: 167 nt
UniGene Fasta |
---|
>sp_v3.0_unigene54028
G |
Ace file of the UniGene sp_v3.0_unigene54028 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Putative gag-pol polyprotein, identical n=2 Tax=Solanum demissum RepID=Q5NRP4_SOLDE | - | - | 5.0e-14 | 68% |
FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 70% |
Sma3 | Gag-Pol polyprotein | - | - | 1.012e-09 | - |
Source | Gene names |
---|---|
Sma3 | AT4g07850; F5K24.1; LOC_Os03g29940; LOC_Os03g35326; LOC_Os10g16560; LOC_Os10g20440; LOC_Os11g23040; LOC_Os12g15350; OJ1122_B08.16; OSJNAa0082N11.12; OSJNBa0003M24.1; OSJNBa0022B03.13; OSJNBa0034E23.18; OSJNBa0038J12.13; OSJNBa0045C13.1; OSJNBa0053F13.6; O |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | cysteine-type peptidase activity | GO:0008234 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Cystathionine beta-synthase, core | IPR000644 | - | 0.0 | - |
Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Short-chain dehydrogenase/reductase SDR | IPR002198 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF21 | IPR002550 | - | 0.0 | - |
Sma3 | Peptidase C48, SUMO/Sentrin/Ubl1 | IPR003653 | - | 0.0 | - |
Sma3 | Transposase, MuDR, plant | IPR004332 | - | 0.0 | - |
Sma3 | Auxin efflux carrier | IPR004776 | - | 0.0 | - |
Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
Sma3 | IPR013084 | - | 0.0 | - | |
Sma3 | Zinc finger, H2C2-type, histone UAS binding | IPR015416 | - | 0.0 | - |
Sma3 | MULE transposase domain | IPR018289 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: A5B9Y2
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 43 aas, your sequence is shorter than subject: 50 - 587
Fln protein:
I
Protein Length:
51
Fln nts:
G
Fln Alignment:
F5X2MQL01CQONK___IVSDRDSKFVGRFWRTLWNKLGTKLSFSSAYHPQIDGQTKVVNRSLGN
A5B9Y2_______________ITSDQDSKFLSPFWRTLWKKFGTKLQYSTSYHPQMDGQTEVVNRSLGD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain