UniGene Name: sp_v3.0_unigene53198
Length: 187 nt
UniGene Fasta |
---|
>sp_v3.0_unigene53198
A |
Ace file of the UniGene sp_v3.0_unigene53198 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Ent-copalyl diphosphate synthase n=3 Tax=Picea RepID=D2X8G0_PICGL | - | - | 2.0e-28 | 98% |
FL-Next | tr=Ent-copalyl diphosphate synthase; Picea glauca (White spruce) (Pinus glauca). | - | - | 0.0 | 98% |
Sma3 | Ent-copalyl diphosphate synthase | - | - | 1.417e-25 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ent-copalyl diphosphate synthase. | EC:5.5.1.13 | - | 9.3e-20 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Diterpenoid biosynthesis | 00904 | 9.3e-20 | % | |
Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 9.3e-20 | % | |
Sma3 | Biosynthesis of plant hormones | 01070 | 9.3e-20 | % | |
Sma3 | Metabolic pathways | 01100 | 9.3e-20 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 9.3e-20 | % |
Source | Gene names |
---|---|
Sma3 | AN1; An2; At4g02780; CPS; CPS1; CPS2; CPSL1; CYC2; CsCPS1; GA1; GSVIVT00023721001; GSVIVT00023723001; LOC_Os02g17780; MtrDRAFT_AC155888g1v2; Os02g0278700; OsI_007598; OsI_06748; OsJ_06244; P0444A09.11; PHYPADRAFT_107108; POPTRDRAFT_798561; PpCPS/KS; RCOM_ |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
Sma3 | ent-copalyl diphosphate synthase activity | GO:0009905 | Molecular Function | 0.0 | - |
Sma3 | lyase activity | GO:0016829 | Molecular Function | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | gibberellin metabolic process | GO:0009685 | Biological Process | 0.0 | - |
Sma3 | gibberellin biosynthetic process | GO:0009686 | Biological Process | 0.0 | - |
Sma3 | gibberellic acid mediated signaling pathway | GO:0009740 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Terpene synthase-like | IPR001906 | - | 0.0 | - |
Sma3 | Terpene synthase, metal-binding domain | IPR005630 | - | 0.0 | - |
Sma3 | Terpenoid synthase | IPR008949 | - | 0.0 | - |
Sma3 | DNA ligase, ATP-dependent, conserved site | IPR016059 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G02780.1 | GA1, ABC33, ATCPS1, CPS, CPS1 Terpenoid cyclases/Protein prenyltransferases superfamily protein chr4:1237881-1244766 REVERSE LENGTH=802 | 7.0e-22 | 62% |
RefSeq | Arabidopsis thaliana | NP_192187.1 | Ent-copalyl diphosphate synthase [Arabidopsis thaliana] | 9.0e-22 | 62% |
RefSeq | Populus trichocarpa | XP_002302110.1 | copalyl diphosphate synthase [Populus trichocarpa] | 7.0e-19 | 58% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D2X8Y7
Fln msg: Distance to subject end: 380 aas, your sequence is shorter than subject: 62 - 761
Fln protein:
R
Protein Length:
63
Fln nts:
A
Fln Alignment:
F5X2MQL01EH7LI___RESPVKDVDDTSMAFRLLRSHGFDVTAEAFNHFKQDDQFFCFFGQTKQTVTGMYNLYRASQ
D2X8Y7_______________RDSPVKDVDDTSMAFRLLRSHGFDVTAEAFNHFKQDDQFFCFFGQTKQTVTGMYNLYRASQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain