UniGene Name: sp_v3.0_unigene52989
Length: 212 nt
UniGene Fasta |
---|
>sp_v3.0_unigene52989
A |
Ace file of the UniGene sp_v3.0_unigene52989 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp|Q9STF3.1|PP265_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g46790, chloroplastic; AltName: Full=Protein CHLORORESPIRATORY REDUCTION 2; Flags: Precursor emb|CAB511 | - | - | 3.0e-17 | 60% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 64% |
Sma3 | Pentatricopeptide (PPR) repeat-containing protein-like | - | - | 5.013e-09 | - |
Source | Gene names |
---|---|
Sma3 | At1g28690; At2g22070; At2g33680; At3g46790; At3g49170; At4g14820; At5g09950; At5g40410; CRR2; EMB2261; F1K23.11; F2K15.30; FCAALL.115; GSVIVT00000282001; GSVIVT00000621001; GSVIVT00001706001; GSVIVT00002423001; GSVIVT00004068001; GSVIVT00006499001; GSVIVT |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
Sma3 | chloroplast RNA processing | GO:0031425 | Biological Process | 0.0 | - |
Sma3 | polycistronic mRNA processing | GO:0031426 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | PAK-box/P21-Rho-binding | IPR000095 | - | 0.0 | - |
Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
Sma3 | Serine/threonine dehydratase, pyridoxal-phosphate-binding site | IPR000634 | - | 0.0 | - |
Sma3 | Legume lectin domain | IPR001220 | - | 0.0 | - |
Sma3 | Adenosine/AMP deaminase domain | IPR001365 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | EGF-like region, conserved site | IPR013032 | - | 0.0 | - |
Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G46790.1 | CRR2 Tetratricopeptide repeat (TPR)-like superfamily protein chr3:17231975-17233948 REVERSE LENGTH=657 | 2.0e-22 | 60% |
RefSeq | Arabidopsis thaliana | NP_190263.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 3.0e-22 | 60% |
RefSeq | Populus trichocarpa | XP_002330519.1 | predicted protein [Populus trichocarpa] | 1.0e-21 | 60% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AB53
Fln msg: Distance to subject end: 52 aas, your sequence is shorter than subject: 70 - 232
Fln protein:
G
Protein Length:
71
Fln nts:
A
Fln Alignment:
F5X2MQL01EM0JQ___AIELFELMILNAMAPNPVTFVGILSACSHAGLVEEGKKYFDSMSHDYFINPEMDHYACMVDLFGR
D5AB53_______________ALDLFEQMKHSDTSPNQVTFVGVLSACCHAGLVSEGRQYFNSMSVDYHITPVMEHYCCMVDLLGR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain