UniGene Name: sp_v3.0_unigene52934
Length: 234 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene52934
A |
Ace file of the UniGene sp_v3.0_unigene52934
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | CDK-activating kinase n=2 Tax=Glycine max RepID=Q6T2Z9_SOYBN | - | - | 1.0e-13 | 53% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 85% |
| Sma3 | Cyclin-dependent kinase F-1 | - | - | 1.508e-08 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cyclin-dependent kinase. | EC:2.7.11.22 | - | 1.33e-08 | - |
| Source | Gene names |
|---|---|
| Sma3 | At4g28980; CAK1; CDKF-1; CHLREDRAFT_102300; FAP247; GSVIVT00016715001; OsI_022018; OsJ_21211; POPTRDRAFT_298370; POPTRDRAFT_809230; RCOM_1052180; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | flagellum | GO:0019861 | Cellular Component | 0.0 | - |
| Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | cyclin-dependent protein kinase activity | GO:0004693 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | RNA polymerase II carboxy-terminal domain kinase activity | GO:0008353 | Molecular Function | 0.0 | - |
| Sma3 | cyclin-dependent protein kinase activating kinase activity | GO:0019912 | Molecular Function | 0.0 | - |
| Sma3 | regulation of cyclin-dependent protein kinase activity | GO:0000079 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | maintenance of root meristem identity | GO:0010078 | Biological Process | 0.0 | - |
| Sma3 | cell division | GO:0051301 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G28980.2 | " CDKF;1, CAK1AT CDK-activating kinase 1AT chr4:14288471-14290102 FORWARD LENGTH=479" | 1.0e-15 | 61% |
| RefSeq | Arabidopsis thaliana | NP_849468.1 | cyclin-dependent kinase F-1 [Arabidopsis thaliana] | 1.0e-15 | 61% |
| RefSeq | Populus trichocarpa | XP_002333979.1 | predicted protein, partial [Populus trichocarpa] | 1.0e-17 | 65% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LR21
Fln msg: Distance to subject end: 111 aas, your sequence is shorter than subject: 78 - 433
Fln protein:
T
Protein Length:
79
Fln nts:
A
Fln Alignment:
F5X2MQL01DK4YO___TSGVGT*WYIAPELLYESTVYGKEIDLWSXXXXXXXXXXXXXXFSETSDIDKLSRLVKVLRSPTEENWSGCSNLP
B8LR21_______________TSGVGTRWYRAPELLYGATIYGKEIDLWSLGCILGELLSLEPLFPGTSDIDQLSRLVKVLGSPTEENWPGCSNLP

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta