|
||||||
|
UniGene Name: sp_v3.0_unigene52905
Length: 211 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene52905
C |
|
Ace file of the UniGene sp_v3.0_unigene52905
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Ubiquitin carrier protein n=2 Tax=Picea sitchensis RepID=B8LR70_PICSI | - | - | 1.0e-25 | 77% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 97% |
| Sma3 | Ubiquitin carrier protein | - | - | 6.056e-17 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ligases, Forming carbon-nitrogen bonds, Acid--D-amino-acid ligases (peptide synthases). | EC:6.3.2.- | - | 1.115e-13 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Tryptophan metabolism | 00380 | 1.115e-13 | % | |
| Sma3 | Biosynthesis of siderophore group nonribosomal peptides | 01053 | 1.115e-13 | % | |
| Sma3 | Ubiquitin--protein ligase. | EC:6.3.2.19 | - | 1.797e-16 | - |
| Source | Gene names |
|---|---|
| Sma3 | 5A1A.8; AP22.89; At1g45050; At1g75440; At4g36410; At5g42990; C7A10.950; F1B16.3; F27F5.13; GSVIVT00014543001; GSVIVT00036869001; LOC_Os03g47770; LOC_Os12g44000; MBD2.19; Os03g0681400; Os03g47770; Os12g0636800; OsI_13035; OsI_39266; OsJ_12122; OsJ_36999; P |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | ubiquitin-protein ligase activity | GO:0004842 | Molecular Function | 0.0 | - |
| Sma3 | small conjugating protein ligase activity | GO:0019787 | Molecular Function | 0.0 | - |
| Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
| Sma3 | response to gibberellin stimulus | GO:0009739 | Biological Process | 0.0 | - |
| Sma3 | negative regulation of flower development | GO:0009910 | Biological Process | 0.0 | - |
| Sma3 | leaf morphogenesis | GO:0009965 | Biological Process | 0.0 | - |
| Sma3 | modification-dependent protein catabolic process | GO:0019941 | Biological Process | 0.0 | - |
| Sma3 | post-translational protein modification | GO:0043687 | Biological Process | 0.0 | - |
| Sma3 | regulation of protein metabolic process | GO:0051246 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ubiquitin-conjugating enzyme, E2 | IPR000608 | - | 0.0 | - |
| Sma3 | Ubiquitin-conjugating enzyme/RWD-like | IPR016135 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G75440.1 | UBC16 ubiquitin-conjugating enzyme 16 chr1:28313623-28314960 FORWARD LENGTH=161 | 8.0e-33 | 94% |
| RefSeq | Arabidopsis thaliana | NP_565110.1 | putative ubiquitin-conjugating enzyme E2 16 [Arabidopsis thaliana] | 1.0e-32 | 94% |
| RefSeq | Populus trichocarpa | XP_002327679.1 | predicted protein [Populus trichocarpa] | 3.0e-33 | 94% |
| Full-Lengther Next Prediction |
|---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: C0PSS5
Fln msg: STOP codon was not found. Distance to subject end: 1 aas, your sequence is shorter than subject: 69 - 105
Fln protein:
H
Protein Length:
70
Fln nts:
C
Fln Alignment:
F5X2MQL01BSXNO___HIYSNGHICLDILYDSWSPAMTVXXXXXXXXXXXXXXT--QRPPDNDRYVKNCRNGRSPKETRWWFHDDKA
C0PSS5_______________HIYSNGHICLDILYDSWSPAMTVSSICISILSMLSSSTVKQRPPDNDRYVKNCRNGRSPKETRWWFHDDKA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
