|
||||||
|
UniGene Name: sp_v3.0_unigene52673
Length: 208 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene52673
A |
|
Ace file of the UniGene sp_v3.0_unigene52673
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | RecName: Full=DEAD-box ATP-dependent RNA helicase 35A dbj|BAD38045.1| putative DEAD-box protein abstrakt [Oryza sativa Japonica Group] | - | - | 9.0e-26 | 86% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 54% |
| Sma3 | Dead box ATP-dependent RNA helicase, putative | - | - | 5.203e-08 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Hydrolases, Acting on acid anhydrides, In phosphorous-containing anhydrides. | EC:3.6.1.- | - | 8.946e-09 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Purine metabolism | 00230 | 8.946e-09 | % | |
| Sma3 | Lipopolysaccharide biosynthesis | 00540 | 8.946e-09 | % | |
| Sma3 | Folate biosynthesis | 00790 | 8.946e-09 | % | |
| Sma3 | Metabolic pathways | 01100 | 8.946e-09 | % |
| Source | Gene names |
|---|---|
| Sma3 | At4g33370; At5g51280; CHLREDRAFT_178281; DRH1; F17M5.130; GSVIVT00003270001; LOC_Os02g05660; LOC_Os06g48210; MICPUCDRAFT_60294; MICPUN_62373; MWD22.23; OSJNBa0050G13.7; Os02g0150100; Os06g0697200; OsI_05864; OsI_24319; OsJ_05388; P0028E05.25; PHATRDRAFT_1 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | ATP-dependent helicase activity | GO:0008026 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | RNA helicase, ATP-dependent, DEAD-box, conserved site | IPR000629 | - | 0.0 | - |
| Sma3 | Helicase, C-terminal | IPR001650 | - | 0.0 | - |
| Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
| Sma3 | DNA/RNA helicase, DEAD/DEAH box type, N-terminal | IPR011545 | - | 0.0 | - |
| Sma3 | Helicase, superfamily 1/2, ATP-binding domain | IPR014001 | - | 0.0 | - |
| Sma3 | RNA helicase, DEAD-box type, Q motif | IPR014014 | - | 0.0 | - |
| Sma3 | IPR014021 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G51280.1 | DEAD-box protein abstrakt, putative chr5:20841456-20843645 FORWARD LENGTH=591 | 1.0e-28 | 80% |
| RefSeq | Arabidopsis thaliana | NP_199941.1 | DEAD-box ATP-dependent RNA helicase 35 [Arabidopsis thaliana] | 1.0e-28 | 80% |
| RefSeq | Populus trichocarpa | XP_002328711.1 | predicted protein [Populus trichocarpa] | 6.0e-33 | 87% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKZ7
Fln msg: Distance to subject end: 331 aas, your sequence is shorter than subject: 69 - 504
Fln protein:
T
Protein Length:
70
Fln nts:
A
Fln Alignment:
F51TW9002G0AUA___ILKKLKAKGIVQPTPIQVQGLPVVLSGRDMIGIAFTGSGKTLVFILPLIM
B8LKZ7_______________VIEEIVKAGFTEPTPIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
