UniGene Name: sp_v3.0_unigene52458
Length: 233 nt
UniGene Fasta |
---|
>sp_v3.0_unigene52458
T |
Ace file of the UniGene sp_v3.0_unigene52458 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Leucyl-tRNA synthetase, putative n=2 Tax=Ricinus communis RepID=B9SKB0_RICCO | - | - | 1.0e-19 | 73% |
FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 90% |
Sma3 | Putative leucyl-tRNA synthetase | - | - | 3.856e-08 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Leucine--tRNA ligase. | EC:6.1.1.4 | - | 9.638e-08 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Valine, leucine and isoleucine biosynthesis | 00290 | 9.638e-08 | % | |
Sma3 | Aminoacyl-tRNA biosynthesis | 00970 | 9.638e-08 | % |
Source | Gene names |
---|---|
Sma3 | AT1G09620; At1g09620; CHLREDRAFT_39075; F21M12.1; GSVIVT00021859001; GSVIVT00035298001; MICPUCDRAFT_46961; MtrDRAFT_AC157893g27v2; OSJNBa0041C07.40; OSTLU_31093; Os09g0378300; Os09g0503400; OsI_31164; OsJ_29173; Ot04g01760; PHYPADRAFT_207285; RCOM_0757640 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | aminoacyl-tRNA ligase activity | GO:0004812 | Molecular Function | 0.0 | - |
Sma3 | leucine-tRNA ligase activity | GO:0004823 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | tRNA aminoacylation for protein translation | GO:0006418 | Biological Process | 0.0 | - |
Sma3 | leucyl-tRNA aminoacylation | GO:0006429 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Aminoacyl-tRNA synthetase, class I, conserved site | IPR001412 | - | 0.0 | - |
Sma3 | Leucyl-tRNA synthetase, class Ia, archaeal/eukaryotic cytosolic | IPR004493 | - | 0.0 | - |
Sma3 | Valyl/Leucyl/Isoleucyl-tRNA synthetase, class I, anticodon-binding | IPR013155 | - | 0.0 | - |
Sma3 | Rossmann-like alpha/beta/alpha sandwich fold | IPR014729 | - | 0.0 | - |
Sma3 | Methionyl/Leucyl tRNA synthetase | IPR015413 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G09620.1 | " ATP binding;leucine-tRNA ligases;aminoacyl-tRNA ligases;nucleotide binding;ATP binding;aminoacyl-tRNA ligases chr1:3113077-3116455 REVERSE LENGTH=1091" | 4.0e-21 | 76% |
RefSeq | Arabidopsis thaliana | NP_172433.2 | leucyl-tRNA synthetase [Arabidopsis thaliana] | 5.0e-21 | 76% |
RefSeq | Populus trichocarpa | XP_002328720.1 | predicted protein [Populus trichocarpa] | 3.0e-20 | 65% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: F6HK37
Fln msg: ERROR#3, very serious frame error, Overlapping hits, possible frame ERROR between 33 and 27, and overlapping frame ERROR between 128 and 128, Distance to subject end: 475 aas, your sequence is shorter than subject: 78 - 1085
Fln protein:
Y
Protein Length:
79
Fln nts:
T
Fln Alignment:
F51TW9002I2I8O___YIIYGEPxxxxFLEECLSKMELYYDEARHGFEHTLSWLNQWACSRSFGLGQEFPGMNSFLVESLSDSTIYMAYYTI
F6HK37_______________YIIYGEPxxxxLAEDCLSNMNLYSDETRHGFEHTLSWLNQWACSRSFGLGTRFPWDEEFLVESLSDSTIYMAYYTV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain