|
||||||
|
UniGene Name: sp_v3.0_unigene52182
Length: 154 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene52182
G |
|
Ace file of the UniGene sp_v3.0_unigene52182
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Aldehyde dehydrogenase family 7 member A1 n=1 Tax=Pisum sativum RepID=AL7A1_PEA | - | - | 4.0e-07 | 70% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 72% |
| Sma3 | Aldehyde dehydrogenase family 7 member A1 | - | - | 1.271e-25 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Aldehyde dehydrogenase (NAD(+)). | EC:1.2.1.3 | - | 4.781e-20 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycolysis / Gluconeogenesis | 00010 | 4.781e-20 | % | |
| Sma3 | Pentose and glucuronate interconversions | 00040 | 4.781e-20 | % | |
| Sma3 | Ascorbate and aldarate metabolism | 00053 | 4.781e-20 | % | |
| Sma3 | Fatty acid metabolism | 00071 | 4.781e-20 | % | |
| Sma3 | Valine, leucine and isoleucine degradation | 00280 | 4.781e-20 | % | |
| Sma3 | Lysine degradation | 00310 | 4.781e-20 | % | |
| Sma3 | Arginine and proline metabolism | 00330 | 4.781e-20 | % | |
| Sma3 | Histidine metabolism | 00340 | 4.781e-20 | % | |
| Sma3 | Tryptophan metabolism | 00380 | 4.781e-20 | % | |
| Sma3 | beta-Alanine metabolism | 00410 | 4.781e-20 | % | |
| Sma3 | Glycerolipid metabolism | 00561 | 4.781e-20 | % | |
| Sma3 | Pyruvate metabolism | 00620 | 4.781e-20 | % | |
| Sma3 | Chloroalkane and chloroalkene degradation | 00625 | 4.781e-20 | % | |
| Sma3 | Propanoate metabolism | 00640 | 4.781e-20 | % | |
| Sma3 | Limonene and pinene degradation | 00903 | 4.781e-20 | % | |
| Sma3 | Metabolic pathways | 01100 | 4.781e-20 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 4.781e-20 | % |
| Source | Gene names |
|---|---|
| Sma3 | ALDH; ALDH7A; ALDH7B4; At1g54100; BTG-26; F15I1.19; GSVIVT00016425001; OJ1344_B01.27-1; Os09g0440300; OsI_31526; OsJ_29519; PHYPADRAFT_110382; POPTRDRAFT_745820; POPTRDRAFT_853157; TP55; VITISV_001496; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | aldehyde dehydrogenase (NAD) activity | GO:0004029 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | cellular aldehyde metabolic process | GO:0006081 | Biological Process | 0.0 | - |
| Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | response to desiccation | GO:0009269 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Aldehyde dehydrogenase domain | IPR015590 | - | 0.0 | - |
| Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
| Sma3 | Aldehyde dehydrogenase, N-terminal | IPR016162 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G54100.1 | ALDH7B4 aldehyde dehydrogenase 7B4 chr1:20195435-20198853 REVERSE LENGTH=508 | 8.0e-11 | 70% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LS13
Fln msg: Distance to subject end: 357 aas, your sequence is shorter than subject: 50 - 511
Fln protein:
I
Protein Length:
51
Fln nts:
G
Fln Alignment:
F51TW9002GQEG0___EWVKILAEGIGEVQELLTCVIMRLGLSRQLNGSIIPSERP
B8LS13_______________EMGKILAEGIGEVQEFIDMCDYAVGLSRQLNGSIIPSERP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
