|
||||||
|
UniGene Name: sp_v3.0_unigene50916
Length: 237 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene50916
C |
|
Ace file of the UniGene sp_v3.0_unigene50916 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Putative alpha-mannosidase [Oryza sativa] gb|AAM08418.1|AC112513_4 Putative alpha-mannosidase [Oryza sativa] | - | - | 3.0e-17 | 63% |
| FL-Next | tr=Lysosomal alpha-mannosidase; Medicago truncatula (Barrel medic) (Medicago tribuloides). | - | - | 0.0 | 62% |
| Sma3 | Lysosomal alpha-mannosidase, putative | - | - | 8.983e-12 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Alpha-mannosidase. | EC:3.2.1.24 | - | 3.144e-11 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Other glycan degradation | 00511 | 3.144e-11 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT3G26720; At3g26720; At5g13980; At5g66150; GSVIVT00017734001; GSVIVT00018036001; GSVIVT00036759001; GSVIVT00037952001; GSVIVT00037953001; LOC_Os10g05069; LOC_Os11g32260; OSJNAa0029P06.4; OSJNBa0029P06.15; Os10g0140200; Os11g0525600; OsI_32713; OsI_36309; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | alpha-mannosidase activity | GO:0004559 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | carbohydrate binding | GO:0030246 | Molecular Function | 0.0 | - |
| Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
| Sma3 | mannose metabolic process | GO:0006013 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycoside hydrolase, family 38, core | IPR000602 | - | 0.0 | - |
| Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
| Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
| Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
| Sma3 | Glycosyl hydrolases 38, C-terminal | IPR011682 | - | 0.0 | - |
| Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
| Sma3 | Glycosyl hydrolase, family 13, all-beta | IPR013780 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 38, central domain | IPR015341 | - | 0.0 | - |
| Sma3 | Heat shock protein DnaJ, conserved site | IPR018253 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G66150.1 | Glycosyl hydrolase family 38 protein chr5:26439013-26444434 REVERSE LENGTH=1047 | 5.0e-21 | 55% |
| RefSeq | Arabidopsis thaliana | NP_201416.1 | Glycosyl hydrolase family 38 protein [Arabidopsis thaliana] | 7.0e-21 | 55% |
| RefSeq | Populus trichocarpa | XP_002321075.1 | predicted protein [Populus trichocarpa] | 1.0e-23 | 58% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: G7KX95
Fln msg: Distance to subject end: 572 aas, your sequence is shorter than subject: 79 - 1082
Fln protein:
L
Protein Length:
80
Fln nts:
C
Fln Alignment:
CL18757Contig1___GRRDSGPKTDLLGDGLALAQHHDAVSGTEKNHTASDYAKRLAIGASQAEEVVNSALSCLT-SSKYYGCRNTLTKFKQC
G7KX95_______________GRKKSGPNTDSLADALAIAQHHDAVTGTEKQHVANDYAKRLAIGYKEAEELVSSSLACLVESTSVTGCHNPVIKFQQC
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
