|
||||||
|
UniGene Name: sp_v3.0_unigene49968
Length: 244 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene49968
C |
|
Ace file of the UniGene sp_v3.0_unigene49968
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Transcription factor (Fragment) n=1 Tax=Lycoris longituba RepID=D6MKQ2_9ASPA | - | - | 2.0e-13 | 46% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 67% |
| Sma3 | AP2/ERF domain-containing transcription factor | - | - | 5.418e-36 | - |
| Source | Gene names |
|---|---|
| Sma3 | 24.t00032; 25.t00062; 27.t00030; ABR1; AP2DCP; AT1G53910; At1g22190; At1g43160; At1g53910; At1g64380; At1g72360; At1g78080; At2g33710; At3g14230; At4g17490; At4g28140; At5g07310; At5g13330; At5g47230; At5g50080; At5g61890; At5g64750; B1011A07.39; BIERF2; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
| Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
| Sma3 | phosphatidylinositol phospholipase C activity | GO:0004435 | Molecular Function | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | lipid metabolic process | GO:0006629 | Biological Process | 0.0 | - |
| Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
| Sma3 | response to osmotic stress | GO:0006970 | Biological Process | 0.0 | - |
| Sma3 | GO:0007242 | Biological Process | 0.0 | - | |
| Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
| Sma3 | response to glucose stimulus | GO:0009749 | Biological Process | 0.0 | - |
| Sma3 | negative regulation of abscisic acid mediated signaling pathway | GO:0009788 | Biological Process | 0.0 | - |
| Sma3 | ethylene mediated signaling pathway | GO:0009873 | Biological Process | 0.0 | - |
| Sma3 | response to chitin | GO:0010200 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ornithine/DAP/Arg decarboxylase | IPR000183 | - | 0.0 | - |
| Sma3 | AP2/ERF domain | IPR001471 | - | 0.0 | - |
| Sma3 | Phospholipase C, phosphatidylinositol-specific, Y domain | IPR001711 | - | 0.0 | - |
| Sma3 | Enolpyruvate transferase domain | IPR001986 | - | 0.0 | - |
| Sma3 | Ubiquinol cytochrome reductase, transmembrane domain | IPR004192 | - | 0.0 | - |
| Sma3 | IPR004348 | - | 0.0 | - | |
| Sma3 | Rieske iron-sulphur protein, C-terminal | IPR005805 | - | 0.0 | - |
| Sma3 | IPR005806 | - | 0.0 | - | |
| Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
| Sma3 | Ubiquinol-cytochrome c reductase, iron-sulphur subunit | IPR006317 | - | 0.0 | - |
| Sma3 | Rieske iron-sulphur protein | IPR014349 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | Rieske [2Fe-2S] iron-sulphur domain | IPR017941 | - | 0.0 | - |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Sma3 | Hemopexin/matrixin, conserved site | IPR018486 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G50080.1 | ERF110 ethylene response factor 110 chr5:20365948-20366835 FORWARD LENGTH=220 | 7.0e-17 | 68% |
| RefSeq | Arabidopsis thaliana | NP_177380.2 | ethylene-responsive transcription factor ERF073 [Arabidopsis thaliana] | 9.0e-17 | 67% |
| RefSeq | Populus trichocarpa | XP_002304640.1 | AP2/ERF domain-containing transcription factor [Populus trichocarpa] | 1.0e-16 | 66% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P288
Fln msg: Distance to subject end: 225 aas, your sequence is shorter than subject: 81 - 429
Fln protein:
K
Protein Length:
82
Fln nts:
C
Fln Alignment:
CL7210Contig1___KHYKGVRMRAWGKWVAEIVDPITRAKVWLGTFDTXXXXXXXXXXXXXXFRGLKAELNFPNEL
A9P288_______________RRYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEDAARAYDDAALKFRGARAKLNFPERV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
