SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene49857

Length: 251 nt

UniGene Fasta

>sp_v3.0_unigene49857
ACAAAGGTGCCTGGACCCAAGAAGAAGATACACGCCTTGTCGCCCACATTCGACTCCACGGGGAAGGCGGCTGGCGTTCCCTTCCCAAGGCAGCAGGACTACTGCGCTGTGGGAAGAGTTGCAGGCTGCGATGGATGAACTACCTGCGTCCAGATCTGAAGCGGAGTAACTTTTCAGAGGAAGAAGATGAACTAATCATCAGACTCCATTCGCTCCTTGATGCAGGAGCATCTAGAACTGAGGAAGACAGT

Ace file of the UniGene sp_v3.0_unigene49857

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	R2R3-MYB transcription factor MYB10 n=1 Tax=Picea glauca RepID=A5JYF4_PICGL	-	-	8.0e-33	88%
FL-Next	tr=R2R3-MYB transcription factor MYB10; Picea glauca (White spruce) (Pinus glauca).	-	-	0.0	88%
Sma3	R2r3-myb transcription factor, putative	-	-	1.113e-13	-

Source	Gene names
Sma3	ATR1; At1g18570; At1g18570/F25I16_4; At1g22640; At1g35515; At1g74080; At2g16720; At3g02940; At3g61250; At4g09460; At4g28110; At4g34990; At4g38620; At5g16770; At5g60890; B1053A04.9; B1215B07.15; B59J16.6; DcMYB3-1; DcMYB3-2; DcMYB5; F12K8.1; F13E7.11; F20M

Source	GOs	Term	Type	Identity
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	cysteine-type peptidase activity	GO:0008234	Molecular Function	-
Sma3	transcription activator activity	GO:0016563	Molecular Function	-
Sma3	tryptophan biosynthetic process	GO:0000162	Biological Process	-
Sma3	defense response to insect	GO:0002213	Biological Process	-
Sma3	regulation of transcription, DNA-dependent	GO:0006355	Biological Process	-
Sma3	proteolysis	GO:0006508	Biological Process	-
Sma3	response to stress	GO:0006950	Biological Process	-
Sma3	response to wounding	GO:0009611	Biological Process	-
Sma3	cold acclimation	GO:0009631	Biological Process	-
Sma3	response to salt stress	GO:0009651	Biological Process	-
Sma3	response to ethylene stimulus	GO:0009723	Biological Process	-
Sma3	response to auxin stimulus	GO:0009733	Biological Process	-
Sma3	response to abscisic acid stimulus	GO:0009737	Biological Process	-
Sma3	response to gibberellin stimulus	GO:0009739	Biological Process	-
Sma3	response to salicylic acid stimulus	GO:0009751	Biological Process	-
Sma3	response to jasmonic acid stimulus	GO:0009753	Biological Process	-
Sma3	indole glucosinolate biosynthetic process	GO:0009759	Biological Process	-
Sma3	cinnamic acid biosynthetic process	GO:0009800	Biological Process	-
Sma3	negative regulation of metabolic process	GO:0009892	Biological Process	-
Sma3	response to chitin	GO:0010200	Biological Process	-
Sma3	cellular response to sulfur starvation	GO:0010438	Biological Process	-
Sma3	cell growth	GO:0016049	Biological Process	-
Sma3	cuticle development	GO:0042335	Biological Process	-
Sma3		GO:0045449	Biological Process	-
Sma3	response to cadmium ion	GO:0046686	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Ketose-bisphosphate aldolase, class-II	IPR000771	-	-
Sma3	SANT/Myb domain	IPR001005	-	-
Sma3	Peptidase C48, SUMO/Sentrin/Ubl1	IPR003653	-	-
Sma3	Transposon, En/Spm-like	IPR004242	-	-
Sma3		IPR012287	-	-
Sma3		IPR014778	-	-
Sma3	Myb transcription factor	IPR015495	-	-
Sma3	Myb-like domain	IPR017877	-	-
Sma3	Myb domain, DNA-binding	IPR017930	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT4G38620.1	ATMYB4, MYB4 myb domain protein 4 chr4:18053866-18054876 FORWARD LENGTH=282	4.00001e-40	86%
RefSeq	Arabidopsis thaliana	NP_195574.1	transcription repressor MYB4 [Arabidopsis thaliana]	5.0e-40	86%
RefSeq	Populus trichocarpa	XP_002306180.1	predicted protein [Populus trichocarpa]	2.0e-40	86%

Full-Lengther Next Prediction

Fln status: Putative N-terminus

Fln database: coniferopsida.fasta

Fln subject: A5JYF4

Fln msg: Distance to subject end: 114 aas, atg_distance in limit (1-15): atg_distance = 14, W2: There is no M at the beginning, your sequence is shorter than subject: 83 - 210

Fln protein: KGAWTQEEDTRLVAHIRLHGEGGWRSLPKAAGLLRCGKSCRLRWMNYLRPDLKRSNFSEEEDELIIRLHSLLDAGASRTEEDS

Protein Length: 84

Fln nts: ACAAAGGTGCCTGGACCCAAGAAGAAGATACACGCCTTGTCGCCCACATTCGACTCCACGGGGAAGGCGGCTGGCGTTCCCTTCCCAAGGCAGCAGGACTACTGCGCTGTGGGAAGAGTTGCAGGCTGCGATGGATGAACTACCTGCGTCCAGATCTGAAGCGGAGTAACTTTTCAGAGGAAGAAGATGAACTAATCATCAGACTCCATTCGCTCCTTGATGCAGGAGCATCTAGAACTGAGGAAGACAGT

Fln Alignment:

CL5640Contig1___KGAWTQEEDTRLVAHIRLHGEGGWRSLPKAAGLLRCGKSCRLRWMNYLRPDLKRSNFSEEEDELIIRLHSLL
A5JYF4_______________KGAWTKEEDDRLIAHIRAHGEGGWRSLPKAAGLLRCGKSCRLRWINYLRPDLKRGNFSEEEDELIIKLHSIL

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain