SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene49409

Length: 297 nt

UniGene Fasta

>sp_v3.0_unigene49409
TGCTGGAGGGATCCATTCCAGAAGAAATCGGCTCCTGCAAATGTTTAACCATTATAAATTTTGCGAGGAACCATCTAAATGGAGCCATTCCATATACTTTGGGATCTATTGAAGTTTTAAATTCTTTGAATCTTTCGAATAACGAGCTCTCCGGATCGATTCCCAGCAGCCTCAGCGCATTGACCCTGAGCTCTATTGATTTCTCCAACAATCAATTAAGCGGTCCCGTTCCCAATTCGCTTCTCAGCGTCGGAAACAGGGGAAGCTTTTCAGGAAATCCAGGGCTTTGTGCTAAAA

Ace file of the UniGene sp_v3.0_unigene49409

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	leucine-rich receptor-like protein kinase [Arabidopsis thaliana] gb\|AAL32758.1\| Unknown protein [Arabidopsis thaliana] gb\|ACN59227.1\| leucine-rich repeat receptor-like protein kinase [Arabidopsis thaliana] gb\|AEE28522.1\| leucine-rich receptor-like protein	-	-	1.0e-16	48%
FL-Next	tr=Clavata-like receptor; Picea glauca (White spruce) (Pinus glauca).	-	-	0.0	46%
Sma3	Leucine Rich Repeat family protein, expressed	-	-	2.975e-06	-

Source	Gene names
Sma3	AT5G65700; At1g09970; At1g09970/F21M12.36; At1g72180; At3g19700; At5g65700; BRI1; CLL1A; F21M12.36; F6H11.170; GSVIVT00008308001; GSVIVT00009145001; GSVIVT00010514001; GSVIVT00010524001; GSVIVT00010645001; GSVIVT00012010001; GSVIVT00015033001; GSVIVT00015

Source	GOs	Term	Type	Identity
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	aminopeptidase activity	GO:0004177	Molecular Function	-
Sma3	protein kinase activity	GO:0004672	Molecular Function	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	protein tyrosine kinase activity	GO:0004713	Molecular Function	-
Sma3	receptor activity	GO:0004872	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	proteolysis	GO:0006508	Biological Process	-
Sma3	regulation of meristem structural organization	GO:0009934	Biological Process	-
Sma3	endosperm development	GO:0009960	Biological Process	-
Sma3	regulation of meristem growth	GO:0010075	Biological Process	-
Sma3	microsporocyte differentiation	GO:0010480	Biological Process	-
Sma3	gametophyte development	GO:0048229	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Alpha/beta hydrolase fold-1	IPR000073	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Serine-threonine/tyrosine-protein kinase catalytic domain	IPR001245	-	-
Sma3	Leucine-rich repeat	IPR001611	-	-
Sma3	Enolpyruvate transferase domain	IPR001986	-	-
Sma3	Peptidase S33	IPR002410	-	-
Sma3	Aminotransferases, class-I, pyridoxal-phosphate-binding site	IPR004838	-	-
Sma3	Proline iminopeptidase	IPR005944	-	-
Sma3	Tyrosine-protein kinase, active site	IPR008266	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	Leucine-rich repeat-containing N-terminal, type 2	IPR013210	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	HTH domain AraC-type, conserved site	IPR018062	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT1G09970.2	LRR XI-23, RLK7 Leucine-rich receptor-like protein kinase family protein chr1:3252408-3255428 FORWARD LENGTH=977	4.0e-21	58%
RefSeq	Arabidopsis thaliana	NP_850942.1	leucine-rich receptor-like protein kinase [Arabidopsis thaliana]	5.0e-21	58%
RefSeq	Populus trichocarpa	XP_002313944.1	predicted protein [Populus trichocarpa]	3.0e-19	58%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: Q19AV8

Fln msg: Distance to subject end: 388 aas, your sequence is shorter than subject: 98 - 998

Fln protein: LEGSIPEEIGSCKCLTIINFARNHLNGAIPYTLGSIEVLNSLNLSNNELSGSIPSSLSALTLSSIDFSNNQLSGPVPNSLLSVGNRGSFSGNPGLCAK

Protein Length: 99

Fln nts: TGCTGGAGGGATCCATTCCAGAAGAAATCGGCTCCTGCAAATGTTTAACCATTATAAATTTTGCGAGGAACCATCTAAATGGAGCCATTCCATATACTTTGGGATCTATTGAAGTTTTAAATTCTTTGAATCTTTCGAATAACGAGCTCTCCGGATCGATTCCCAGCAGCCTCAGCGCATTGACCCTGAGCTCTATTGATTTCTCCAACAATCAATTAAGCGGTCCCGTTCCCAATTCGCTTCTCAGCGTCGGAAACAGGGGAAGCTTTTCAGGAAATCCAGGGCTTTGTGCTAAAA

Fln Alignment:

CL21470Contig1___LEGSIPEEIGSCKCLTIINFARNHLNGAIPYTLGSIEVXXXXXXXXXXXXXXIPSSLSALTLSSIDFSNNQLSGPVPNSLLSVGNRGSFSGNPGLCAK
Q19AV8_______________LSGELPAEISSCKQLGEINLSKNQFSGSIPASVGTLPVLNYLDLSDNLLTGLIPSEFGNLKLNTFDVSNNRLSGAVPLAFANPVYEKSFLGNPELCSR

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain