|
||||||
|
UniGene Name: sp_v3.0_unigene49299
Length: 158 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene49299
C |
|
Ace file of the UniGene sp_v3.0_unigene49299
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Whole genome shotgun sequence of line PN40024, scaffold_2.assembly12x (Fragment) n=1 Tax=Vitis vinifera RepID=D7U026_VITVI | - | - | 9.0e-16 | 76% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 96% |
| Sma3 | Multidrug resistance protein ABC transporter family | - | - | 4.922e-27 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Xenobiotic-transporting ATPase. | EC:3.6.3.44 | - | 3.354e-11 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g04120; At3g13080; At3g21250; At3g59140; B1065G12.13; EST2; F17J16.190; F20D22.11; GSVIVT00002476001; GSVIVT00002478001; GSVIVT00002482001; GSVIVT00002485001; GSVIVT00002488001; GSVIVT00002490001; GSVIVT00006470001; GSVIVT00006491001; GSVIVT00018959001 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plant-type vacuole | GO:0000325 | Cellular Component | 0.0 | - |
| Sma3 | vacuolar membrane | GO:0005774 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | sulfonylurea receptor activity | GO:0008281 | Molecular Function | 0.0 | - |
| Sma3 | xenobiotic-transporting ATPase activity | GO:0008559 | Molecular Function | 0.0 | - |
| Sma3 | chlorophyll catabolite transmembrane transporter activity | GO:0010290 | Molecular Function | 0.0 | - |
| Sma3 | glutathione S-conjugate-exporting ATPase activity | GO:0015431 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity, coupled to transmembrane movement of substances | GO:0042626 | Molecular Function | 0.0 | - |
| Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | cellular potassium ion homeostasis | GO:0030007 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Neuraxin/MAP1B repeat | IPR000102 | - | 0.0 | - |
| Sma3 | Aminotransferase, class V/Cysteine desulfurase | IPR000192 | - | 0.0 | - |
| Sma3 | ABC transporter, transmembrane domain | IPR001140 | - | 0.0 | - |
| Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
| Sma3 | ABC transporter, integral membrane type 1 | IPR017940 | - | 0.0 | - |
| Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
| Sma3 | Hemopexin/matrixin, conserved site | IPR018486 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G21250.2 | MRP6, ABCC8 multidrug resistance-associated protein 6 chr3:7457668-7463261 REVERSE LENGTH=1464 | 4.0e-19 | 71% |
| RefSeq | Arabidopsis thaliana | NP_188762.3 | multidrug resistance-associated protein 6 [Arabidopsis thaliana] | 5.0e-19 | 71% |
| RefSeq | Populus trichocarpa | XP_002327533.1 | multidrug resistance protein ABC transporter family, partial [Populus trichocarpa] | 1.0e-19 | 75% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NSU0
Fln msg: Distance to subject end: 28 aas, your sequence is shorter than subject: 52 - 131
Fln protein:
S
Protein Length:
53
Fln nts:
C
Fln Alignment:
CL20199Contig1___SIDSATDALVQKVIRHEFSNCTVIIIAHRVPTVIDSDMVLTLSDGKLAEYD
A9NSU0_______________SIDSATDALLQKVIRHEFSNCTVITIAHRVPTVIDSDMVLTLSDGKLAEYD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
