UniGene Name: sp_v3.0_unigene48997
Length: 180 nt
![]() |
---|
>sp_v3.0_unigene48997
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Omega-6 desaturase n=1 Tax=Gossypium hirsutum RepID=O23956_GOSHI | - | - | 2.0e-23 | 81% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 79% |
Sma3 | Delta-12 fatty acid desaturase | - | - | 4.844e-29 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Oxidoreductases, Acting on paired donors, with incorporation or reduction of molecular oxygen, With oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water. | EC:1.14.19.- | - | 1.225e-10 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | alpha-Linolenic acid metabolism | 00592 | 1.225e-10 | % | |
Sma3 | Biosynthesis of unsaturated fatty acids | 01040 | 1.225e-10 | % | |
Sma3 | Delta(12)-fatty acid dehydrogenase. | EC:1.14.99.33 | - | 1.212e-09 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Linoleic acid metabolism | 00591 | 1.212e-09 | % | |
Sma3 | Phosphatidylcholine desaturase. | EC:1.3.1.35 | - | 8.663e-11 | - |
Source | Gene names |
---|---|
Sma3 | At3g12120; CHLREDRAFT_135825; CvFad2; DLS1; DLS2; ELI12; ELI7.1; ELI7.2; ELI7.4; ELI7.5; ELI7.6; ELI7.7; ELI7.8; ELI7.9; FAD; FAD12; FAD2; FAD2-1; FAD2-1A; FAD2-1B; FAD2-2; FAD2-3; FAD2-4; FAD2B; FADX; Fac2; Fad2; FadS; FadX; GSVIVT00024716001; GSVIVT0002 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | endoplasmic reticulum membrane | GO:0005789 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | delta12-fatty acid dehydrogenase activity | GO:0016720 | Molecular Function | 0.0 | - |
Sma3 | omega-6 fatty acid desaturase activity | GO:0045485 | Molecular Function | 0.0 | - |
Sma3 | phosphatidylcholine desaturase activity | GO:0050184 | Molecular Function | 0.0 | - |
Sma3 | lipid metabolic process | GO:0006629 | Biological Process | 0.0 | - |
Sma3 | fatty acid biosynthetic process | GO:0006633 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Fatty acid desaturase, type 1 | IPR005804 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G12120.1 | FAD2 fatty acid desaturase 2 chr3:3860592-3861743 REVERSE LENGTH=383 | 1.0e-29 | 79% |
RefSeq | Arabidopsis thaliana | NP_001078140.1 | omega-6 fatty acid desaturase, endoplasmic reticulum [Arabidopsis thaliana] | 1.0e-29 | 79% |
RefSeq | Populus trichocarpa | XP_002297660.1 | predicted protein [Populus trichocarpa] | 2.0e-28 | 76% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NUQ3
Fln msg: Distance to subject end: 71 aas, your sequence is shorter than subject: 59 - 375
Fln protein:
I
Protein Length:
60
Fln nts:
T
Fln Alignment:
CL16789Contig1___IKVYGIPLLIVNAFLVLITCLQHTHPALPHYDGSEWEWMRGALSTVDRDYGMLNHVFHH
A9NUQ3_______________IKLYAIPLLIVNGFLVLITYLQHTHPALPHYDSSEWEWLRGALLTMDRDFGIWNHVLHH
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain