UniGene Name: sp_v3.0_unigene48912
Length: 248 nt
![]() |
---|
>sp_v3.0_unigene48912
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Methionine S-methyltransferase n=2 Tax=Hordeum vulgare RepID=MMT1_HORVU | - | - | 9.0e-34 | 81% |
FL-Next | sp=Methionine S-methyltransferase; Hordeum vulgare (Barley). | - | - | 0.0 | 81% |
Sma3 | Methionine S-methyltransferase | - | - | 7.124e-21 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Methionine S-methyltransferase. | EC:2.1.1.12 | - | 7.58e-26 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Selenocompound metabolism | 00450 | 7.58e-26 | % |
Source | Gene names |
---|---|
Sma3 | At5g49810; GSVIVT00035361001; K21G20.2; MMT; MMT1; MtrDRAFT_AC140551g25v2; OSJNBb0035J08.4; Os05g0105000; OsI_18110; OsJ_16807; P0668H12.19; PHYPADRAFT_122377; PHYPADRAFT_164756; POPTRDRAFT_596793; RCOM_0825000; VITISV_013862; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
Sma3 | transferase activity, transferring nitrogenous groups | GO:0016769 | Molecular Function | 0.0 | - |
Sma3 | pyridoxal phosphate binding | GO:0030170 | Molecular Function | 0.0 | - |
Sma3 | methionine S-methyltransferase activity | GO:0030732 | Molecular Function | 0.0 | - |
Sma3 | biosynthetic process | GO:0009058 | Biological Process | 0.0 | - |
Sma3 | S-adenosylmethionine metabolic process | GO:0046500 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Aminotransferase, class I/classII | IPR004839 | - | 0.0 | - |
Sma3 | Methyltransferase small | IPR007848 | - | 0.0 | - |
Sma3 | Methyltransferase type 11 | IPR013216 | - | 0.0 | - |
Sma3 | Pyridoxal phosphate-dependent transferase, major region, subdomain 1 | IPR015421 | - | 0.0 | - |
Sma3 | Pyridoxal phosphate-dependent transferase, major region, subdomain 2 | IPR015422 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G49810.1 | MMT methionine S-methyltransferase chr5:20239418-20246046 FORWARD LENGTH=1071 | 8.0e-40 | 75% |
RefSeq | Arabidopsis thaliana | NP_199792.1 | methionine S-methyltransferase [Arabidopsis thaliana] | 1.0e-39 | 75% |
RefSeq | Populus trichocarpa | XP_002328809.1 | methionine s-methyltransferase [Populus trichocarpa] | 2.0e-37 | 73% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9MBC2
Fln msg: Distance to subject end: 706 aas, your sequence is shorter than subject: 82 - 1088
Fln protein:
Q
Protein Length:
83
Fln nts:
C
Fln Alignment:
CL15951Contig1___QITKLWQTRVIQAADTDISALVEIEKNSRHRFEFFMGLVSDEPICARTAWAYAKSGGQISHALSVYSCELRQPNNVKVIFDF
Q9MBC2_______________RINKLWQTKIMQAADTDISALVEIEKNSRHRFEFFMDLVGDQPVCARTAWAYMKSGGRISHALSVYSCQLRQPNQVKKIFEF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain