|
||||||
|
UniGene Name: sp_v3.0_unigene48829
Length: 213 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene48829
T |
|
Ace file of the UniGene sp_v3.0_unigene48829
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | DNA polymerase n=1 Tax=Selaginella moellendorffii RepID=D8SJG5_SELML | - | - | 1.0e-18 | 64% |
| FL-Next | sp=DNA polymerase; Selaginella moellendorffii (Spikemoss). | - | - | 0.0 | 64% |
| Sma3 | DNA polymerase | - | - | 1.32e-23 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | DNA-directed DNA polymerase. | EC:2.7.7.7 | - | 2.653e-25 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Purine metabolism | 00230 | 2.653e-25 | % | |
| Sma3 | Pyrimidine metabolism | 00240 | 2.653e-25 | % | |
| Sma3 | Metabolic pathways | 01100 | 2.653e-25 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g08260; At2g27120; GSVIVT00022048001; MICPUCDRAFT_51203; MICPUN_63095; OSJNBa0001A11.28; Os02g0511900; OsI_07377; OsJ_06880; PHYPADRAFT_136896; POPTRDRAFT_594813; RCOM_0792580; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | epsilon DNA polymerase complex | GO:0008622 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | nucleotide binding | GO:0000166 | Molecular Function | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | DNA-directed DNA polymerase activity | GO:0003887 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | DNA replication | GO:0006260 | Biological Process | 0.0 | - |
| Sma3 | positive regulation of S phase of mitotic cell cycle | GO:0045750 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | RNA polymerase sigma-70 factor | IPR000943 | - | 0.0 | - |
| Sma3 | Aminotransferase, class-II, pyridoxal-phosphate binding site | IPR001917 | - | 0.0 | - |
| Sma3 | DNA-directed DNA polymerase, family B, exonuclease domain | IPR006133 | - | 0.0 | - |
| Sma3 | DNA-directed DNA polymerase, family B, multifunctional domain | IPR006134 | - | 0.0 | - |
| Sma3 | DNA-directed DNA polymerase, family B | IPR006172 | - | 0.0 | - |
| Sma3 | DNA polymerase epsilon, catalytic subunit A, C-terminal | IPR013697 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G08260.1 | EMB142, EMB2284, POL2A, TIL1, EMB529, ABO4, ESD7 DNA polymerase epsilon catalytic subunit chr1:2590944-2606892 FORWARD LENGTH=2161 | 8.0e-22 | 65% |
| RefSeq | Arabidopsis thaliana | NP_172303.5 | DNA polymerase epsilon subunit 1 [Arabidopsis thaliana] | 1.0e-21 | 65% |
| RefSeq | Populus trichocarpa | XP_002328167.1 | predicted protein [Populus trichocarpa] | 2.0e-21 | 64% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: D8SJG5
Fln msg: Distance to subject end: 2214 aas, your sequence is shorter than subject: 70 - 2410
Fln protein:
E
Protein Length:
71
Fln nts:
T
Fln Alignment:
CL14979Contig1___EKEDLDLKNHLSGMRRTYLKVSFDTVQDLTHVKSDLLPVVERNQAKLEASEAFESFFSGRS---DNKQRIQDY
D8SJG5_______________EKEDLDLKNHLSGLRKRFIKISFNTVQDLMQVKSDLMPIVARNQAKLEAVEAYESVLYGLSTEKQNKSKVYDY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
