|
||||||
|
UniGene Name: sp_v3.0_unigene48442
Length: 236 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene48442
C |
|
Ace file of the UniGene sp_v3.0_unigene48442
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Dynamin central region; Dynamin [Medicago truncatula] | - | - | 4.0e-27 | 79% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 53% |
| Sma3 | Phragmoplastin | - | - | 3.604e-11 | - |
| Source | Gene names |
|---|---|
| Sma3 | ADL2; ADL2A; ADL2B; At2g14120; At4g33650; B1793G04.8-1; CHLREDRAFT_195430; CHLREDRAFT_195431; DRP1; DRP3; DRP3A; DRP3B; DYN1; Dnm1; GSVIVT00001878001; GSVIVT00006741001; GSVIVT00008612001; GSVIVT00032811001; MICPUCDRAFT_36259; MICPUN_107250; MICPUN_64379; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | peroxisome | GO:0005777 | Cellular Component | 0.0 | - |
| Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
| Sma3 | microtubule | GO:0005874 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | motor activity | GO:0003774 | Molecular Function | 0.0 | - |
| Sma3 | GTPase activity | GO:0003924 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | branched-chain-amino-acid transaminase activity | GO:0004084 | Molecular Function | 0.0 | - |
| Sma3 | GTP binding | GO:0005525 | Molecular Function | 0.0 | - |
| Sma3 | phosphatidylinositol binding | GO:0035091 | Molecular Function | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | cell cycle | GO:0007049 | Biological Process | 0.0 | - |
| Sma3 | peroxisome fission | GO:0016559 | Biological Process | 0.0 | - |
| Sma3 | cell division | GO:0051301 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Dynamin central domain | IPR000375 | - | 0.0 | - |
| Sma3 | G-patch domain | IPR000467 | - | 0.0 | - |
| Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
| Sma3 | Dynamin, GTPase domain | IPR001401 | - | 0.0 | - |
| Sma3 | Dynamin GTPase effector | IPR003130 | - | 0.0 | - |
| Sma3 | Dynamin, GTPase region, conserved site | IPR019762 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G14120.3 | - | 4.0e-33 | 79% |
| RefSeq | Arabidopsis thaliana | NP_565362.1 | dynamin-related protein 3B [Arabidopsis thaliana] | 4.0e-33 | 79% |
| RefSeq | Populus trichocarpa | XP_002309855.1 | predicted protein [Populus trichocarpa] | 2.0e-35 | 84% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLP8
Fln msg: Distance to subject end: 349 aas, your sequence is shorter than subject: 78 - 608
Fln protein:
N
Protein Length:
79
Fln nts:
C
Fln Alignment:
CL9900Contig1___NSDLANSDALQIARIADIDGSRTIGVITKLDIMDRGTDASNLLLGNVIPLRLGYIGVVNRSQEDIIANKSI
B8LLP8_______________NQDLATSDAIKISREVDPKGERTFGVLTKVDLMDKGTNAVDILEGKAYRLQFPWVGVVNRSQADI--NKSV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
