UniGene Name: sp_v3.0_unigene45833
Length: 237 nt
![]() |
---|
>sp_v3.0_unigene45833
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Unassigned protein | - | - | 0.0 | - |
FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 55% |
Source | Gene names |
---|---|
Sma3 | LOC_Os12g20040; OSJNBb0058J09.16; VITISV_000409; VITISV_002563; VITISV_003321; VITISV_003603; VITISV_003734; VITISV_005022; VITISV_005871; VITISV_006308; VITISV_007059; VITISV_007652; VITISV_008256; VITISV_008842; VITISV_009214; VITISV_009524; VITISV_0095 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromosome | GO:0005694 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | DNA topoisomerase type I activity | GO:0003917 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | DNA topological change | GO:0006265 | Biological Process | 0.0 | - |
Sma3 | DNA unwinding involved in replication | GO:0006268 | Biological Process | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | KID repeat | IPR003900 | - | 0.0 | - |
Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
Sma3 | IPR006154 | - | 0.0 | - | |
Sma3 | Toprim domain | IPR006171 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 16, active site | IPR008263 | - | 0.0 | - |
Sma3 | EGF-like region, conserved site | IPR013032 | - | 0.0 | - |
Sma3 | DNA topoisomerase, type IA, central region, subdomain 1 | IPR013824 | - | 0.0 | - |
![]() |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: A5BVM1
Fln msg: Distance to subject end: 610 aas, your sequence is shorter than subject: 79 - 810
Fln protein:
I
Protein Length:
80
Fln nts:
A
Fln Alignment:
CL22183Contig1___IKDFSKLASPMFGLLAKDVEFNWTDDCQRALNELKDKLVSAPILRGPDWALPFHIHTDASNKAIGAALGQVEEKLPYAI
A5BVM1_______________IKDFSKIAKPLCELLVKDAKFEWDDKCQRSFELLKQFLTSAPIVRAPNWELPFEVMCDSSDYAIGAILGQIEDGKPYVI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain