UniGene Name: sp_v3.0_unigene44687
Length: 160 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene44687
A |
Ace file of the UniGene sp_v3.0_unigene44687
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | oxoglutarate dehydrogenase - like protein [Arabidopsis thaliana] | - | - | 5.0e-16 | 83% |
| FL-Next | tr=Putative uncharacterized protein; Oryza sativa subsp. japonica (Rice). | - | - | 0.0 | 84% |
| Sma3 | 2-oxoglutarate dehydrogenase, E1 subunit | - | - | 3.279e-09 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Oxoglutarate dehydrogenase (succinyl-transferring). | EC:1.2.4.2 | - | 1.309e-15 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Citrate cycle (TCA cycle) | 00020 | 1.309e-15 | % | |
| Sma3 | Lysine degradation | 00310 | 1.309e-15 | % | |
| Sma3 | Tryptophan metabolism | 00380 | 1.309e-15 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 1.309e-15 | % | |
| Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 1.309e-15 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 1.309e-15 | % | |
| Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 1.309e-15 | % | |
| Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 1.309e-15 | % | |
| Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 1.309e-15 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 1.309e-15 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.309e-15 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.309e-15 | % |
| Source | Gene names |
|---|---|
| Sma3 | At3g55410; At5g65750; CHLREDRAFT_79471; F6H11.130; MICPUCDRAFT_35900; MICPUN_104793; OGD1; OSIGBa0096P03.7; OSTLU_49109; Os04g0390000; Os07g0695800; OsI_15669; OsJ_14584; P0627E10.28; PHYPADRAFT_159607; PHYPADRAFT_175076; POPTRDRAFT_724772; POPTRDRAFT_820 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | oxoglutarate dehydrogenase (succinyl-transferring) activity | GO:0004591 | Molecular Function | 0.0 | - |
| Sma3 | thiamine pyrophosphate binding | GO:0030976 | Molecular Function | 0.0 | - |
| Sma3 | glycolysis | GO:0006096 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Dehydrogenase, E1 component | IPR001017 | - | 0.0 | - |
| Sma3 | Transketolase-like, pyrimidine-binding domain | IPR005475 | - | 0.0 | - |
| Sma3 | 2-oxoglutarate dehydrogenase, E1 component | IPR011603 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G55410.1 | 2-oxoglutarate dehydrogenase, E1 component chr3:20541897-20545728 FORWARD LENGTH=1017 | 5.0e-21 | 86% |
| RefSeq | Arabidopsis thaliana | NP_191101.2 | 2-oxoglutarate dehydrogenase, E1 component [Arabidopsis thaliana] | 6.0e-21 | 86% |
| RefSeq | Populus trichocarpa | XP_002312072.1 | predicted protein [Populus trichocarpa] | 9.0e-22 | 86% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: B9FEW6
Fln msg: Distance to subject end: 671 aas, your sequence is shorter than subject: 53 - 999
Fln protein:
S
Protein Length:
54
Fln nts:
A
Fln Alignment:
CL8725Contig1___SADLGVESIVIGMSHRGRLNVLGNVVRKPLRQIFSEFSGGIKPAGAETGWYTG
B9FEW6_______________AADLGVESIVIGMPHRGRLNVLGNVVRKPLRQIFSEFSGGTKPAEEGEGLYTG

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta