UniGene Name: sp_v3.0_unigene44656
Length: 243 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene44656
T |
Ace file of the UniGene sp_v3.0_unigene44656 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Actin binding protein, putative n=1 Tax=Ricinus communis RepID=B9SA03_RICCO | - | - | 1.0e-20 | 76% |
| FL-Next | sp=Formin-like protein 18; Oryza sativa subsp. japonica (Rice). | - | - | 0.0 | 73% |
| Sma3 | Formin-like protein 8 | - | - | 8.621e-08 | - |
| Source | Gene names |
|---|---|
| Sma3 | AFH1; At1g24150; At1g59910; At1g70140; At2g43800; At3g05470; At3g25500; At4g15200/At4g15190; At5g48360; At5g54650; At5g67470; B1103G11.53; B1160F02.7; Dl3645c/Dl3640c; F18O19.9; F20P5.14; F22F7.8; F23H11.22; F3I6.8; FCAALL.218; FH1; FH10; FH11; FH13; FH15 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | spindle | GO:0005819 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | cell-cell junction | GO:0005911 | Cellular Component | 0.0 | - |
| Sma3 | phragmoplast | GO:0009524 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | actin binding | GO:0003779 | Molecular Function | 0.0 | - |
| Sma3 | profilin binding | GO:0005522 | Molecular Function | 0.0 | - |
| Sma3 | actin filament binding | GO:0051015 | Molecular Function | 0.0 | - |
| Sma3 | exocytosis | GO:0006887 | Biological Process | 0.0 | - |
| Sma3 | cell tip growth | GO:0009932 | Biological Process | 0.0 | - |
| Sma3 | cellular component organization | GO:0016043 | Biological Process | 0.0 | - |
| Sma3 | actin cytoskeleton organization | GO:0030036 | Biological Process | 0.0 | - |
| Sma3 | actin filament polymerization | GO:0030041 | Biological Process | 0.0 | - |
| Sma3 | actin nucleation | GO:0045010 | Biological Process | 0.0 | - |
| Sma3 | vesicle docking | GO:0048278 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Actin-binding FH2/DRF autoregulatory | IPR003104 | - | 0.0 | - |
| Sma3 | Exocyst complex component Sec10 | IPR009976 | - | 0.0 | - |
| Sma3 | Actin-binding FH2 | IPR015425 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G54650.1 | Fh5, ATFH5 formin homology5 chr5:22197856-22201649 REVERSE LENGTH=900 | 1.0e-24 | 75% |
| RefSeq | Arabidopsis thaliana | NP_200276.1 | formin-like protein 5 [Arabidopsis thaliana] | 2.0e-24 | 75% |
| RefSeq | Populus trichocarpa | XP_002319800.1 | predicted protein, partial [Populus trichocarpa] | 1.0e-24 | 65% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q6MWG9
Fln msg: Distance to subject end: 214 aas, your sequence is shorter than subject: 80 - 906
Fln protein:
K
Protein Length:
81
Fln nts:
T
Fln Alignment:
CL8263Contig1___KTGNRMNSGTNRGGAQAFNLNTLLKLADVKGTDGKTTLLHFVVHEIIRSEGKRIAEAADQSHSSSNATS
Q6MWG9_______________KTGNRMNDGTFRGGAQAFKLDTLLKLADVKGVDGKTTLLHFVVQEIIRSEGVRAARAASGGGGGSSISS

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)