UniGene Name: sp_v3.0_unigene43448
Length: 214 nt
![]() |
---|
>sp_v3.0_unigene43448
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp|O49399.2|PP321_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g18840 emb|CAA16741.2| putative protein [Arabidopsis thaliana] emb|CAB78886.1| putative protein [Arabid | - | - | 6.0e-19 | 57% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 71% |
Sma3 | Pentatricopeptide repeat-containing protein, putative | - | - | 6.471e-15 | - |
Source | Gene names |
---|---|
Sma3 | A_TM021B04.2; At1g13410; At1g74630; At2g03880; At2g13600; At3g16610; At3g29230; At3g49710; At4g02750; At4g14820; At4g18840; At4g33990; At4g38010; At5g19020; At5g27110; At5g56310; B1032F05.19; EMB2758; F13C5.10; F17I5.180; F1M20.31; F20D10.130; FCAALL.115; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | diacylglycerol kinase activity | GO:0004143 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway | GO:0007205 | Biological Process | 0.0 | - |
Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G18840.1 | Pentatricopeptide repeat (PPR-like) superfamily protein chr4:10338719-10340356 REVERSE LENGTH=545 | 2.0e-24 | 57% |
RefSeq | Arabidopsis thaliana | NP_193619.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 2.0e-24 | 57% |
RefSeq | Populus trichocarpa | XP_002305377.1 | predicted protein [Populus trichocarpa] | 1.0e-24 | 62% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AB53
Fln msg: Distance to subject end: 53 aas, your sequence is shorter than subject: 70 - 232
Fln protein:
H
Protein Length:
71
Fln nts:
T
Fln Alignment:
CL16321Contig1___HGCGKEALKLFQEMQQSGMKPDSVTFVNVLSACCHAGLVDEGRKYFNSMSQCYQITPVIEHYGCMVDLVG
D5AB53_______________HGCGKQALDLFEQMKHSDTSPNQVTFVGVLSACCHAGLVSEGRQYFNSMSVDYHITPVMEHYCCMVDLLG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain