|
||||||
|
UniGene Name: sp_v3.0_unigene43331
Length: 245 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene43331
T |
|
Ace file of the UniGene sp_v3.0_unigene43331
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | EIN3-like transcription factor [Rosa hybrid cultivar] | - | - | 3.0e-28 | 70% |
| FL-Next | sp=Protein ETHYLENE INSENSITIVE 3; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 66% |
| Sma3 | Ethylene signal transcription factor | - | - | 1.352e-15 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g73730; At2g27050; At3g20770; At5g10120; At5g21120; At5g65100; B1168A08.22; CmEIL1; CmEIL2; EIL; EIL1; EIL2; EIL3; EIL4; EIL5; EIN3; EIN3A; EIN3B; EIN3C; EIN3D; EIN3E1; EIN3F; EIN3a; EIN3b; F25P22.15; GSVIVT00008539001; GSVIVT00017405001; GSVIVT0002466 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
| Sma3 | transporter activity | GO:0005215 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | transcription regulator activity | GO:0030528 | Molecular Function | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
| Sma3 | ethylene mediated signaling pathway | GO:0009873 | Biological Process | 0.0 | - |
| Sma3 | sugar mediated signaling pathway | GO:0010182 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ribonuclease A | IPR001427 | - | 0.0 | - |
| Sma3 | Sodium/solute symporter | IPR001734 | - | 0.0 | - |
| Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
| Sma3 | Ethylene insensitive 3 | IPR006957 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 16, active site | IPR008263 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat 2 | IPR013101 | - | 0.0 | - |
| Sma3 | Aldo/keto reductase, conserved site | IPR018170 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G20770.1 | EIN3, AtEIN3 Ethylene insensitive 3 family protein chr3:7260702-7262588 REVERSE LENGTH=628 | 1.0e-32 | 66% |
| RefSeq | Arabidopsis thaliana | NP_188713.1 | protein ethylene insensitive 3 [Arabidopsis thaliana] | 2.0e-32 | 66% |
| RefSeq | Populus trichocarpa | XP_002315400.1 | ethylene-insensitive 3c [Populus trichocarpa] | 3.0e-34 | 71% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: O24606
Fln msg: Distance to subject end: 430 aas, your sequence is shorter than subject: 81 - 628
Fln protein:
Y
Protein Length:
82
Fln nts:
T
Fln Alignment:
CL14820Contig1___YGIIPEKGKPVSGASDNIRAWWKEKVKFDKNGPVAIAKYQAENSPLGVQKNHVIATSTSYSLQDLQDTTLGSLLSSLMQHC
O24606_______________YGIIPENGKPVTGASDNLREWWKDKVRFDRNGPAAITKYQAENNIPGIHEGNNPIGPTPHTLQELQDTTLGSLLSALMQHC
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
