UniGene Name: sp_v3.0_unigene39878
Length: 193 nt
![]() |
---|
>sp_v3.0_unigene39878
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Unassigned protein | - | - | 0.0 | - |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 95% |
Sma3 | Quinone oxidoreductase-like protein | - | - | 6.448e-24 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | 2-alkenal reductase. | EC:1.3.1.74 | - | 2.844e-11 | - |
Source | Gene names |
---|---|
Sma3 | At1g26320; At3g03080; At5g16960; At5g16970; At5g16980; At5g16980/F2K13_130; At5g16990; At5g17000; At5g37940; At5g37980; At5g38000; B1078G07.5; Dbr1; F28B23.3; F2K13_110; F2K13_120; F2K13_130; F2K13_140; F2K13_150; GSVIVT00004110001; GSVIVT00012147001; GSV |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | 2-alkenal reductase [NAD(P)] activity | GO:0032440 | Molecular Function | 0.0 | - |
Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase superfamily, zinc-type | IPR002085 | - | 0.0 | - |
Sma3 | IPR013084 | - | 0.0 | - | |
Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase, C-terminal | IPR013149 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G16990.1 | Zinc-binding dehydrogenase family protein chr5:5581831-5583849 REVERSE LENGTH=343 | 9.0e-24 | 63% |
RefSeq | Arabidopsis thaliana | NP_197201.1 | 2-alkenal reductase [Arabidopsis thaliana] | 1.0e-23 | 63% |
RefSeq | Populus trichocarpa | XP_002331654.1 | predicted protein, partial [Populus trichocarpa] | 2.0e-24 | 65% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P0J2
Fln msg: Distance to subject end: 192 aas, your sequence is shorter than subject: 64 - 344
Fln protein:
S
Protein Length:
65
Fln nts:
T
Fln Alignment:
CL16264Contig1___SNHPDFKEDDLVMGITGWEEYSIIPGGNQLQKIKYTDVPLSYYLGILGMPGLTAYVGFYDLTSP
A9P0J2_______________SNHPDFKEDDLVMGITGWEEYSIIPGGNQLQKIRYTDIPLSYYLGILGMPGLTAYVGFYDLSSP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain