|
||||||
|
UniGene Name: sp_v3.0_unigene34668
Length: 193 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene34668
T |
|
Ace file of the UniGene sp_v3.0_unigene34668
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | aconitate hydratase [Pseudomonas entomophila L48] emb|CAK14741.1| putative aconitate hydratase [Pseudomonas entomophila L48] | - | - | 1.0e-21 | 82% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 56% |
| Sma3 | Aconitase | - | - | 1.1e-07 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Aconitate hydratase. | EC:4.2.1.3 | - | 6.281e-07 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Citrate cycle (TCA cycle) | 00020 | 6.281e-07 | % | |
| Sma3 | Glyoxylate and dicarboxylate metabolism | 00630 | 6.281e-07 | % | |
| Sma3 | Carbon fixation pathways in prokaryotes | 00720 | 6.281e-07 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 6.281e-07 | % | |
| Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 6.281e-07 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 6.281e-07 | % | |
| Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 6.281e-07 | % | |
| Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 6.281e-07 | % | |
| Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 6.281e-07 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 6.281e-07 | % | |
| Sma3 | Metabolic pathways | 01100 | 6.281e-07 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 6.281e-07 | % |
| Source | Gene names |
|---|---|
| Sma3 | ACO; GSVIVT00026023001; GSVIVT00027318001; IRP1; LOC_Os03g04410; LOC_Os08g09200; Os03g0136900; Os08g0191100; OsI_09921; OsI_28098; OsJ_09326; OsJ_26310; P0610E02.32; PHYPADRAFT_147035; VITISV_029521; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | aconitate hydratase activity | GO:0003994 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | 4 iron, 4 sulfur cluster binding | GO:0051539 | Molecular Function | 0.0 | - |
| Sma3 | glyoxylate cycle | GO:0006097 | Biological Process | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Aconitase A/isopropylmalate dehydratase small subunit, swivel | IPR000573 | - | 0.0 | - |
| Sma3 | Aconitase/3-isopropylmalate dehydratase large subunit, alpha/beta/alpha | IPR001030 | - | 0.0 | - |
| Sma3 | Aconitase/iron regulatory protein 2 | IPR006249 | - | 0.0 | - |
| Sma3 | Aconitase/3-isopropylmalate dehydratase, swivel | IPR015928 | - | 0.0 | - |
| Sma3 | Aconitase/3-isopropylmalate dehydratase large subunit, alpha/beta/alpha, subdomain 1/3 | IPR015931 | - | 0.0 | - |
| Sma3 | Aconitase/3-isopropylmalate dehydratase large subunit, alpha/beta/alpha, subdomain 2 | IPR015932 | - | 0.0 | - |
| Sma3 | Aconitase/Iron regulatory protein 2/2-methylisocitrate dehydratase | IPR015934 | - | 0.0 | - |
| Sma3 | Aconitase/isopropylmalate dehydratase | IPR015937 | - | 0.0 | - |
| Sma3 | Aconitase family, 4Fe-4S cluster binding site | IPR018136 | - | 0.0 | - |
| Sma3 | PDZ-binding protein, CRIPT | IPR019367 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G26970.1 | ACO2 aconitase 2 chr4:13543077-13548427 FORWARD LENGTH=995 | 5.0e-14 | 56% |
| RefSeq | Arabidopsis thaliana | NP_567763.2 | aconitase 2 [Arabidopsis thaliana] | 6.0e-14 | 56% |
| RefSeq | Populus trichocarpa | XP_002331755.1 | predicted protein [Populus trichocarpa] | 1.0e-13 | 56% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NX49
Fln msg: Distance to subject end: 286 aas, your sequence is shorter than subject: 63 - 565
Fln protein:
A
Protein Length:
64
Fln nts:
T
Fln Alignment:
Contig34668___SPPLVVAYAIAGTVRFDIENDVL-TVVDGKEIRLKDIWPSDEEIDAIVKASVKPEMF
A9NX49_______________SPPLVVAYALAGTVDIDFETEPIGTGKDGKKVYFRDIWPSTEEIAEVVHSAVLPDMF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
