|
||||||
|
UniGene Name: sp_v3.0_unigene30927
Length: 231 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene30927
C |
|
Ace file of the UniGene sp_v3.0_unigene30927
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | TIR-NBS-LRR class disease resistance protein n=4 Tax=Arabidopsis thaliana RepID=F4I270_ARATH | - | - | 3.0e-15 | 58% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 72% |
| Source | Gene names |
|---|---|
| Sma3 | At1g69550; F10D13_24; POPTRDRAFT_585925; POPTRDRAFT_595612; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intrinsic to membrane | GO:0031224 | Cellular Component | 0.0 | - |
| Sma3 | transmembrane signaling receptor activity | GO:0004888 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
| Sma3 | apoptotic process | GO:0006915 | Biological Process | 0.0 | - |
| Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
| Sma3 | innate immune response | GO:0045087 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Toll/interleukin-1 receptor homology (TIR) domain | IPR000157 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
| Sma3 | NB-ARC | IPR002182 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat 3 | IPR011713 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G69550.1 | disease resistance protein (TIR-NBS-LRR class) chr1:26148836-26153374 REVERSE LENGTH=1400 | 6.0e-20 | 58% |
| RefSeq | Arabidopsis thaliana | NP_564971.2 | TIR-NBS-LRR class disease resistance protein [Arabidopsis thaliana] | 8.0e-20 | 58% |
| RefSeq | Populus trichocarpa | XP_002334784.1 | predicted protein [Populus trichocarpa] | 1.0e-19 | 54% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PQE2
Fln msg: Distance to subject end: 41 aas, your sequence is shorter than subject: 76 - 1071
Fln protein:
L
Protein Length:
77
Fln nts:
C
Fln Alignment:
Contig30927___LQSLHLEWCSSMQTLPDSVGNLSGLQSLHLEECWSLQTLPDSVGNLSGLQSLHLEECSSLQTLPDSVGNLSVLK
C0PQE2_______________LQTLALGWCSTLQTLPDSVGNLTGLQTLDLIECSTLQTLPDSVGNLTGLQTLYLSRCSTLQTLPDSVGNLTGLQ
| SNPs (tot: 21) |
|---|
| Position | A % | C % | G % | T % | Probability |
|---|---|---|---|---|---|
| 81 | 15 | 84 | 0.999986 | ||
| 86 | 8 | 75 | 16 | 0.99999 | |
| 92 | 42 | 57 | 1.0 | ||
| 93 | 71 | 28 | 1.0 | ||
| 94 | 71 | 28 | 1.0 | ||
| 95 | 16 | 66 | 16 | 0.988813 | |
| 96 | 83 | 16 | 0.994512 | ||
| 101 | 16 | 16 | 66 | 0.988813 | |
| 102 | 16 | 50 | 33 | 1.0 | |
| 103 | 33 | 50 | 16 | 1.0 | |
| 106 | 16 | 83 | 0.994512 | ||
| 111 | 83 | 16 | 0.994512 | ||
| 159 | 33 | 66 | 0.997452 | ||
| 161 | 66 | 33 | 0.997452 | ||
| 165 | 33 | 33 | 33 | 0.997753 | |
| 166 | 66 | 33 | 0.997452 | ||
| 167 | 66 | 33 | 0.997452 | ||
| 168 | 33 | 66 | 0.997452 | ||
| 169 | 66 | 33 | 0.997452 | ||
| 176 | 66 | 33 | 0.997452 | ||
| 187 | 66 | 33 | 0.997452 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
