UniGene Name: sp_v3.0_unigene210272
Length: 246 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene210272
A |
Ace file of the UniGene sp_v3.0_unigene210272
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | 40S ribosomal protein S3a-1 [Arabidopsis thaliana] sp|Q9CAV0.3|RS3A1_ARATH RecName: Full=40S ribosomal protein S3a-1 gb|AAG51414.1|AC009465_14 putative 40S ribosomal protein S3A (S phase specific); 75194-73527 [Arabidopsis thaliana] gb|AAL32874.1| putativ | - | - | 2.0e-33 | 85% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 89% |
| Sma3 | 40S ribosomal protein S3a | - | - | 1.041e-24 | - |
| Source | Gene names |
|---|---|
| Sma3 | 40SRPS3a; AT4G34670; At3g04840; At4g34670; BIS289; CHLREDRAFT_168484; CYC07; GSVIVT00020038001; GSVIVT00031140001; LOC_Os03g10340; MICPUCDRAFT_49648; MICPUN_95475; OJ1115_D03.49; OJ1756_H07.11; OSTLU_28528; Os02g0287000; Os03g0200500; Os12g0406200; OsI_06 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
| Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | cytosolic small ribosomal subunit | GO:0022627 | Cellular Component | 0.0 | - |
| Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ribosomal protein S3Ae | IPR001593 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
| Sma3 | Basic-leucine zipper domain | IPR004827 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 43 | IPR006710 | - | 0.0 | - |
| Sma3 | Beta tubulin, autoregulation binding site | IPR013838 | - | 0.0 | - |
| Sma3 | Ribosomal protein S3Ae, conserved site | IPR018281 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G04840.1 | Ribosomal protein S3Ae chr3:1329751-1331418 FORWARD LENGTH=262 | 9.94922e-44 | 85% |
| RefSeq | Arabidopsis thaliana | NP_187135.1 | 40S ribosomal protein S3a-1 [Arabidopsis thaliana] | 2.00386e-43 | 85% |
| RefSeq | Populus trichocarpa | XP_002328352.1 | predicted protein [Populus trichocarpa] | 1.96182e-44 | 84% |
Full-Lengther Next Prediction |
|---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NNV8
Fln msg: STOP codon was not found. Distance to subject end: 15 aas, your sequence is shorter than subject: 82 - 245
Fln protein:
S
Protein Length:
83
Fln nts:
A
Fln Alignment:
uma_euler_40509___SQIRQIRRKMREIMVREATSCDLKELVAKFIPEVIGKEI------IYPLQNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKVDR
A9NNV8________________SQIRQIRRKMTEIMIREASSCDLKELVAKFIPEVIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKVDR

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta