SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene209749

Length: 315 nt

UniGene Fasta

>sp_v3.0_unigene209749
ACATCCCACTCATTGTTACTGAAAGCGGATGGCCTTCTGGTGGCGCGGATGTGGCCACAGTTGCGAATGCTCAGGCTTACAACAACAATCTCATCCGCCATGTATTATCAAATGCAGGGACACCCAAGAGGCCCGGAACTAGCATTGAGACCTATATCTTCGCTCTTTTCAACGAAGACCAGAAAACAGGGGCCGAGATAGAGCGTCACTTCGGGCTCTTCAACCCTGATCAAAGTCCTGCATACTCTGTCAACTTTTCTCCAAGTTGACCGCAACTCAGTTCTCCTTAACTATTTGTATGCAAAATGCAATGAT

Ace file of the UniGene sp_v3.0_unigene209749

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Pollen allergen CJP38 n=1 Tax=Cryptomeria japonica RepID=Q588B8_CRYJA	-	-	4.0e-33	75%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	84%
Sma3	Beta-1,3-glucanase	-	-	0.0	-

Source	ECs	Term	Type	e value	Identity
Sma3	Glucan endo-1,3-beta-D-glucosidase.	EC:3.2.1.39	-	0.0	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Starch and sucrose metabolism	00500		0.0	%

Source	Gene names
Sma3	1; 3 beta gluc; At1g66250; B1142C05.26; BG2-1; BG2-2; BG2-3; BGL32; BHVG1; CC2920; GGL1; GGL4; GSVIVT00016644001; GSVIVT00022221001; GSVIVT00022223001; GSVIVT00025340001; GSVIVT00030570001; GSVIVT00032980001; GSVIVT00033125001; Glb3; Glu; Glu I; Glu1; Glu

Source	GOs	Term	Type	Identity
Sma3	extracellular region	GO:0005576	Cellular Component	-
Sma3	proteinaceous extracellular matrix	GO:0005578	Cellular Component	-
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	vacuole	GO:0005773	Cellular Component	-
Sma3	anchored to plasma membrane	GO:0046658	Cellular Component	-
Sma3	apoplast	GO:0048046	Cellular Component	-
Sma3	hydrolase activity, hydrolyzing O-glycosyl compounds	GO:0004553	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	glucan endo-1,3-beta-D-glucosidase activity	GO:0042973	Molecular Function	-
Sma3	cation binding	GO:0043169	Molecular Function	-
Sma3	carbohydrate metabolic process	GO:0005975	Biological Process	-
Sma3	apoptotic process	GO:0006915	Biological Process	-
Sma3	defense response	GO:0006952	Biological Process	-
Sma3	response to biotic stimulus	GO:0009607	Biological Process	-
Sma3	plant-type hypersensitive response	GO:0009626	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Peptidase, cysteine peptidase active site	IPR000169	-	-
Sma3	GPCR, rhodopsin-like, 7TM	IPR000276	-	-
Sma3	Glycoside hydrolase, family 17	IPR000490	-	-
Sma3	Leucine-rich repeat	IPR001611	-	-
Sma3	NB-ARC	IPR002182	-	-
Sma3	Immunoglobulin/major histocompatibility complex, conserved site	IPR003006	-	-
Sma3	X8	IPR012946	-	-
Sma3	Glycoside hydrolase, subgroup, catalytic domain	IPR013781	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT4G16260.1	Glycosyl hydrolase superfamily protein chr4:9200180-9201441 REVERSE LENGTH=344	3.0e-25	50%
RefSeq	Arabidopsis thaliana	NP_193361.4	catalytic/ cation binding / hydrolase [Arabidopsis thaliana]	3.0e-25	50%
RefSeq	Populus trichocarpa	XP_002330523.1	predicted protein [Populus trichocarpa]	2.0e-26	54%

Full-Lengther Next Prediction

Fln status: Putative C-terminus

Fln database: coniferopsida.fasta

Fln subject: D5AD06

Fln msg: query STOP codon is far from subject stop. Distance to subject end: 22 aas, your sequence is shorter than subject: 89 - 230

Fln protein: IPLIVTESGWPSGGADVATVANAQAYNNNLIRHVLSNAGTPKRPGTSIETYIFALFNEDQKTGAEIERHFGLFNPDQSPAYSVNFSPS*

Protein Length: 90

Fln nts: ACATCCCACTCATTGTTACTGAAAGCGGATGGCCTTCTGGTGGCGCGGATGTGGCCACAGTTGCGAATGCTCAGGCTTACAACAACAATCTCATCCGCCATGTATTATCAAATGCAGGGACACCCAAGAGGCCCGGAACTAGCATTGAGACCTATATCTTCGCTCTTTTCAACGAAGACCAGAAAACAGGGGCCGAGATAGAGCGTCACTTCGGGCTCTTCAACCCTGATCAAAGTCCTGCATACTCTGTCAACTTTTCTCCAAGTTGA___CCGCAACTCAGTTCTCCTTAACTATTTGTATGCAAAATGCAATGAT

Fln Alignment:

Tip_euler_2205___IPLIVTESGWPSGGADVATVANAQAYNNNLIRHVLSNAGTPKRPGTSIETYIFALFNEDQKTGAEIERHFGLFNPDQSPAYSVNF
D5AD06________________IPLIVTESGWPSGGEDVATVDNARAYNNNLIRHVLSNAGTPKRPGTSIETYIFSLFNEDKKTGAETERHFGLFYPNQQSVYPVSF

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain