UniGene Name: sp_v2.0_unigene74647
Length: 139 nt
Origin of reads:
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v2.0_unigene74647
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Ubiquitin n=1 Tax=Capsaspora owczarzaki ATCC 30864 RepID=E9CCU3_9EUKA | - | - | 7.0e-13 | 90% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 97% |
Blast2go | cnpv096 ubiquitin | - | - | 8.84226e-19 | 99% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | cell cycle checkpoint | GO:0000075 | Biological Process | 8.84226e-19 | 99% |
Blast2go | negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle | GO:0051436 | Biological Process | 8.84226e-19 | 99% |
Blast2go | MyD88-independent toll-like receptor signaling pathway | GO:0002756 | Biological Process | 8.84226e-19 | 99% |
Blast2go | regulation of signal transduction | GO:0009966 | Biological Process | 8.84226e-19 | 99% |
Blast2go | anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process | GO:0031145 | Biological Process | 8.84226e-19 | 99% |
Blast2go | induction of apoptosis by extracellular signals | GO:0008624 | Biological Process | 8.84226e-19 | 99% |
Blast2go | anti-apoptosis | GO:0006916 | Biological Process | 8.84226e-19 | 99% |
Blast2go | MyD88-dependent toll-like receptor signaling pathway | GO:0002755 | Biological Process | 8.84226e-19 | 99% |
Blast2go | RNA metabolic process | GO:0016070 | Biological Process | 8.84226e-19 | 99% |
Blast2go | response to DNA damage stimulus | GO:0006974 | Biological Process | 8.84226e-19 | 99% |
Blast2go | regulation of cell communication | GO:0010646 | Biological Process | 8.84226e-19 | 99% |
Blast2go | interphase of mitotic cell cycle | GO:0051329 | Biological Process | 8.84226e-19 | 99% |
Blast2go | epidermal growth factor receptor signaling pathway | GO:0007173 | Biological Process | 8.84226e-19 | 99% |
Blast2go | positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle | GO:0051437 | Biological Process | 8.84226e-19 | 99% |
Blast2go | cellular membrane organization | GO:0016044 | Biological Process | 8.84226e-19 | 99% |
Blast2go | stress-activated protein kinase signaling cascade | GO:0031098 | Biological Process | 8.84226e-19 | 99% |
Blast2go | I-kappaB kinase/NF-kappaB cascade | GO:0007249 | Biological Process | 8.84226e-19 | 99% |
Blast2go | translation | GO:0006412 | Biological Process | 8.84226e-19 | 99% |
Blast2go | MAPK cascade | GO:0000165 | Biological Process | 8.84226e-19 | 99% |
Blast2go | protein binding | GO:0005515 | Molecular Function | 8.84226e-19 | 99% |
Blast2go | cytosol | GO:0005829 | Cellular Component | 8.84226e-19 | 99% |
Blast2go | nucleoplasm | GO:0005654 | Cellular Component | 8.84226e-19 | 99% |
Blast2go | endosome membrane | GO:0010008 | Cellular Component | 8.84226e-19 | 99% |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ubiquitin | IPR000626 | - | 0.0 | - |
Sma3 | Ribosomal protein 60S | IPR001813 | - | 0.0 | - |
Sma3 | Ribosomal protein L40e | IPR001975 | - | 0.0 | - |
Sma3 | Ribosomal protein S27a | IPR002906 | - | 0.0 | - |
Sma3 | Actin-like | IPR004000 | - | 0.0 | - |
Sma3 | Actin, conserved site | IPR004001 | - | 0.0 | - |
Sma3 | Superoxide dismutase, Nickel-type | IPR014123 | - | 0.0 | - |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LP57
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 44 aas, your sequence is shorter than subject: 38 - 128
Fln protein:
D
Protein Length:
39
Fln nts:
G
Fln Alignment:
AllPineV4_rep_c107947___DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG
B8LP57_______________DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain