SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: uagpf v2.0

UniGene Name: uagpf_v2_unigene52796

Length: 500 nt

UniGene Fasta

>uagpf_v2_unigene52796
CGTCGTGACCTTGGCTGTCACTCAGCTGTTATAATTTCATGCAGAAAGGGTGGCACCAGTATTGAAGACCTTGCAGAAAAGTATCCTGACGTCGTGACCTTGGCTGTCACTATATTTTCGAAGGAATAACAGATGAAGATGCTGCAAAAGTTGTCGAAGGTCTGGCCCCCACACTTGCTGATAGAGATGCATCAATAGATCAAGTAAAAAAGCTGTATGGTCTATTCTGTGAAACAGACTGTACACTTCTTGAGATCAATCCGATTGCAGAGACTGTTGATGGCCAATTAGTGGCTGCTGATGCAAAACTCAATTTTGATGACAATGCTGCGTATCGCCAGAAAGAGATTTTTGCTTTCCGTGATAAATCTCAAGAGGATCCAAGAGAGGTTTCTGCTGCTGAGGCTGACTTGAACTATATTGGATTGGATGGAGAAATAGGATGCATGGTTAATGGTGCAGGGTTGGCAATGGCAACCATGGATATCATAAAATTACAT

Ace file of the UniGene uagpf_v2_unigene52796

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
SustainPine v2.0	sp_v2.0_unigene16844	6/6

Source	Descriptions	Term	Type	Identity
AutoFact	succinyl CoA ligase beta subunit-like protein [Solanum tuberosum]	-	-	78%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	70%
Blast2go	succinyl- ligase	-	-	89%

Source	ECs	Term	Type	e value	Identity
Blast2go	Succinate--CoA ligase (ADP-forming).	EC:6.2.1.5	-	0.0	89%

Source	KEGGs	Term	Identity
Blast2go	Citrate cycle (TCA cycle)	00020	89%
Blast2go	Propanoate metabolism	00640	89%
Blast2go	C5-Branched dibasic acid metabolism	00660	89%
Blast2go	Carbon fixation pathways in prokaryotes	00720	89%
Blast2go	Biosynthesis of phenylpropanoids	01061	89%
Blast2go	Biosynthesis of terpenoids and steroids	01062	89%
Blast2go	Biosynthesis of alkaloids derived from shikimate pathway	01063	89%
Blast2go	Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid	01064	89%
Blast2go	Biosynthesis of alkaloids derived from histidine and purine	01065	89%
Blast2go	Biosynthesis of alkaloids derived from terpenoid and polyketide	01066	89%
Blast2go	Biosynthesis of plant hormones	01070	89%
Blast2go	Metabolic pathways	01100	89%
Blast2go	Biosynthesis of secondary metabolites	01110	89%

Source	GOs	Term	Type	Identity
Blast2go	response to cadmium ion	GO:0046686	Biological Process	89%
Blast2go	succinyl-CoA metabolic process	GO:0006104	Biological Process	89%
Blast2go	succinate metabolic process	GO:0006105	Biological Process	89%
Blast2go	tricarboxylic acid cycle	GO:0006099	Biological Process	89%
Blast2go	copper ion binding	GO:0005507	Molecular Function	89%
Blast2go	ATP binding	GO:0005524	Molecular Function	89%
Blast2go	succinate-CoA ligase (ADP-forming) activity	GO:0004775	Molecular Function	89%
Blast2go	mitochondrion	GO:0005739	Cellular Component	89%

Source	InterPros	Term	Type	Identity
Sma3	ATP-grasp fold	IPR011761	-	-
Sma3	ATP-grasp fold, succinyl-CoA synthetase-type	IPR013650	-	-
Sma3	ATP-grasp fold, subdomain 2	IPR013816	-	-
Sma3	ATP-citrate lyase/succinyl-CoA ligase	IPR005811	-	-
Sma3	Succinyl-CoA synthetase, beta subunit, conserved site	IPR017866	-	-
Sma3	Succinyl-CoA synthetase, beta subunit	IPR005809	-	-
Sma3	Succinyl-CoA synthetase-like	IPR016102	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: D5A8F9

Fln msg: Overlapping hits, possible frame ERROR between 117 and 114, Distance to subject end: 108 aas, your sequence is shorter than subject: 167 - 425

Fln protein: RRDLGCHSAVIISCRKGGTSIEDLAEKYPDVVTLAVTxxxEGITDEDAAKVVEGLAPTLADRDASIDQVKKLYGLFCETDCTLLEINPIAETVDGQLVAADAKLNFDDNAAYRQKEIFAFRDKSQEDPREVSAAEADLNYIGLDGEIGCMVNGAGLAMATMDIIKLH

Protein Length: 168

Fln nts: CGTCGTGACCTTGGCTGTCACTCAGCTGTTATAATTTCATGCAGAAAGGGTGGCACCAGTATTGAAGACCTTGCAGAAAAGTATCCTGACGTCGTGACCTTGGCTGTCACTxxxxxxxxxGAAGGAATAACAGATGAAGATGCTGCAAAAGTTGTCGAAGGTCTGGCCCCCACACTTGCTGATAGAGATGCATCAATAGATCAAGTAAAAAAGCTGTATGGTCTATTCTGTGAAACAGACTGTACACTTCTTGAGATCAATCCGATTGCAGAGACTGTTGATGGCCAATTAGTGGCTGCTGATGCAAAACTCAATTTTGATGACAATGCTGCGTATCGCCAGAAAGAGATTTTTGCTTTCCGTGATAAATCTCAAGAGGATCCAAGAGAGGTTTCTGCTGCTGAGGCTGACTTGAACTATATTGGATTGGATGGAGAAATAGGATGCATGGTTAATGGTGCAGGGTTGGCAATGGCAACCATGGATATCATAAAATTACAT

Fln Alignment:

uagpf_mira_rep_c73901___VIISCRKGGTSIEDLAEKYPD-VVTLAVTxxEGITDEDAAKVVEGLAPTLADRDASIDQVKKLYGLFCETDCTLLEINPIAETVDGQLVAADAKLNFDDNAAYRQKEIFAFRDKSQEDPREVSAAEADLNYIGLDGEIGCMVNGAGLAMATMDIIKLH
D5A8F9________________VIISCSKGGTSIEDLAEKYPDMIIKVPIDxxKGITDEDAAKVVEGLAPRLADRDASIDQIKKLYGLFRETDCTLLEINPIAETVDGQLVAADAKMNFDDNAAYRQKDIFSFRDKSQEDPREVSAAEADLNYIGLDGEIGCMVNGAGLAMATMDIIKLH

SNPs (tot: 23)

Position	A %	C %	G %	T %	Probability
93	40		60		1.0
95		60	40		1.0
96	40		60		1.0
98	40		60		1.0
100		60		40	1.0
102	40			60	1.0
103	50			50	1.0
106		50		50	1.0
108		50	50		1.0
109		50		50	1.0
110		50		50	1.0
112		50		50	1.0
114		20	40		1.0
116		50		50	1.0
201		16	83		0.994514
202	83		16		0.994514
205	83		16		0.994514
206	83			16	0.994514
210	80	20			0.995493
211	80	20			0.995493
212	83			16	0.994523
213	83			16	0.994519
214	83		16		0.994519

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain