|
||||||
|
UniGene Name: uagpf_v2_unigene46746
Length: 222 nt
 UniGene Fasta
|
|---|
| >uagpf_v2_unigene46746
C |
|
Ace file of the UniGene uagpf_v2_unigene46746
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene6778 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Receptor protein kinase CLAVATA1, putative n=1 Tax=Ricinus communis RepID=B9R6R4_RICCO | - | - | 0.0 | 62% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 70% |
| Blast2go | receptor protein kinase clavata1 | - | - | 0.0 | 76% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Transferases, Transferring phosphorous-containing groups, Protein-serine/threonine kinases. | EC:2.7.11.- | - | 0.0 | 76% |
| Blast2go | 2-alkenal reductase. | EC:1.3.1.74 | - | 0.0 | 76% |
| Blast2go | Receptor protein-tyrosine kinase. | EC:2.7.10.1 | - | 0.0 | 76% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | 76% |
| Blast2go | protein autophosphorylation | GO:0046777 | Biological Process | 0.0 | 76% |
| Blast2go | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | 76% |
| Blast2go | seed germination | GO:0009845 | Biological Process | 0.0 | 76% |
| Blast2go | transmembrane receptor protein tyrosine kinase signaling pathway | GO:0007169 | Biological Process | 0.0 | 76% |
| Blast2go | peptidase activity | GO:0008233 | Molecular Function | 0.0 | 76% |
| Blast2go | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | 76% |
| Blast2go | 2-alkenal reductase [NAD(P)] activity | GO:0032440 | Molecular Function | 0.0 | 76% |
| Blast2go | ATP binding | GO:0005524 | Molecular Function | 0.0 | 76% |
| Blast2go | transmembrane receptor protein tyrosine kinase activity | GO:0004714 | Molecular Function | 0.0 | 76% |
| Blast2go | integral to membrane | GO:0016021 | Cellular Component | 0.0 | 76% |
| Blast2go | micropyle | GO:0070825 | Cellular Component | 0.0 | 76% |
| Blast2go | plasma membrane | GO:0005886 | Cellular Component | 0.0 | 76% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Alpha/beta hydrolase fold-1 | IPR000073 | - | 0.0 | - |
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
| Sma3 | Enolpyruvate transferase domain | IPR001986 | - | 0.0 | - |
| Sma3 | Peptidase S33 | IPR002410 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat, typical subtype | IPR003591 | - | 0.0 | - |
| Sma3 | Aminotransferases, class-I, pyridoxal-phosphate-binding site | IPR004838 | - | 0.0 | - |
| Sma3 | Proline iminopeptidase | IPR005944 | - | 0.0 | - |
| Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | HTH domain AraC-type, conserved site | IPR018062 | - | 0.0 | - |
| Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9P1G6
Fln msg: STOP codon was not found. Distance to subject end: 1 aas, your sequence is shorter than subject: 74 - 291
Fln protein:
R
Protein Length:
75
Fln nts:
C
Fln Alignment:
uagpf_mira_rep_c47762___ISCRISTRESTFELIDSRIPDIYKESVIKVLKIAVLCTSHLPAMRPFMREVVDLLLGADPY
A9P1G6________________ISRNIATRDSTLEVIDSRIPEIYKQRMTKVLKIAALCTDHLPALRPSMRVVVDLLLKADPF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
