|
||||||
|
UniGene Name: uagpf_v2_unigene40812
Length: 244 nt
 UniGene Fasta
|
|---|
| >uagpf_v2_unigene40812
C |
|
Ace file of the UniGene uagpf_v2_unigene40812
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene5012 | 3/3 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | putative PDR-like ABC transporter [Oryza sativa Japonica Group] | - | - | 0.0 | 63% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 67% |
| Blast2go | atp-binding cassette | - | - | 0.0 | 79% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Heme-transporting ATPase. | EC:3.6.3.41 | - | 0.0 | 79% |
| Blast2go | Phosphonate-transporting ATPase. | EC:3.6.3.28 | - | 0.0 | 79% |
| Blast2go | Polyamine-transporting ATPase. | EC:3.6.3.31 | - | 0.0 | 79% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | ATP catabolic process | GO:0006200 | Biological Process | 0.0 | 79% |
| Blast2go | heme-transporting ATPase activity | GO:0015439 | Molecular Function | 0.0 | 79% |
| Blast2go | organic phosphonate transmembrane-transporting ATPase activity | GO:0015416 | Molecular Function | 0.0 | 79% |
| Blast2go | ATP binding | GO:0005524 | Molecular Function | 0.0 | 79% |
| Blast2go | polyamine-transporting ATPase activity | GO:0015417 | Molecular Function | 0.0 | 79% |
| Blast2go | mitochondrion | GO:0005739 | Cellular Component | 0.0 | 79% |
| Blast2go | membrane | GO:0016020 | Cellular Component | 0.0 | 79% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ribosomal protein L11 | IPR000911 | - | 0.0 | - |
| Sma3 | Legume lectin domain | IPR001220 | - | 0.0 | - |
| Sma3 | DNA methylase, N-6 adenine-specific, conserved site | IPR002052 | - | 0.0 | - |
| Sma3 | Proteinase inhibitor I2, Kunitz metazoa | IPR002223 | - | 0.0 | - |
| Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | ATPase, AAA-type, core | IPR003959 | - | 0.0 | - |
| Sma3 | Pleiotropic drug resistance protein PDR | IPR005285 | - | 0.0 | - |
| Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
| Sma3 | ABC-2 type transporter | IPR013525 | - | 0.0 | - |
| Sma3 | Plant PDR ABC transporter associated | IPR013581 | - | 0.0 | - |
| Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ACV1
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 288 aas, your sequence is shorter than subject: 70 - 412
Fln protein:
R
Protein Length:
71
Fln nts:
C
Fln Alignment:
uagpf_mira_rep_c38590___LGCHSHKLVEYFEAIDGVSKIKDGYNPATWMLEVSSLAVETRLGIDFADIYRNSDLYQRNKALIKD*ARPI
D5ACV1________________VGHHSYKLIEYFEAIPGVPKIRDGYNPATWMLEISSPAAETHLGVDFAEVYSNSPLFQRNQALIKELSTPV
| SNPs (tot: 1) |
|---|
| Position | A % | C % | G % | T % | Probability |
|---|---|---|---|---|---|
| 191 | 66 | 33 | 0.997471 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
