SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: biogeco2 v2.0

UniGene Name: biog2_v2.0_unigene16984

Length: 274 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>biog2_v2.0_unigene16984
ATGGGGGGGATCAACCTGGCCACCGCAGATACTGTTATAATATATGACAGTGACTGGAATCCACATGCAGATTTGCAGGCAATGGCTAGGGCTCATCGCCTTGGACAGACCAATAAGGTGATGATTTTCAGGCTTGTTAATAGGGGAACTATTGATGAGCGAATGATGCAGCTGACAAAGAAGAAAATGATTCTTGAGCACCTTGTTGTTGGTCGTCTGAAAACTCAAACAGGCCTCAATCAGGAAGAGTTAGATGATATCTTGCGGTATGGAG

Ace file of the UniGene biog2_v2.0_unigene16984 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
SustainPine v2.0	sp_v2.0_unigene46819	2/2

Source	Descriptions	Term	Type	e value	Identity
AutoFact	CHD3-type chromatin-remodeling factor PICKLE n=2 Tax=Arabidopsis RepID=PKL_ARATH	-	-	6.99949e-42	88%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	52%
Blast2go	chromatin remodeling complex subunit	-	-	0.0	94%

Source	ECs	Term	Type	e value	Identity
Blast2go	Nucleoside-triphosphatase.	EC:3.6.1.15	-	0.0	94%

Source	KEGGs	Term	Identity
Blast2go	Purine metabolism	00230	94%
Blast2go	Thiamine metabolism	00730	94%
Blast2go	Metabolic pathways	01100	94%

Source	GOs	Term	Type	Identity
Blast2go	negative regulation of abscisic acid mediated signaling pathway	GO:0009788	Biological Process	94%
Blast2go	response to gibberellin stimulus	GO:0009739	Biological Process	94%
Blast2go	cell proliferation	GO:0008283	Biological Process	94%
Blast2go	negative regulation of transcription, DNA-dependent	GO:0045892	Biological Process	94%
Blast2go	cytokinin mediated signaling pathway	GO:0009736	Biological Process	94%
Blast2go	response to auxin stimulus	GO:0009733	Biological Process	94%
Blast2go	nucleoside-triphosphatase activity	GO:0017111	Molecular Function	94%
Blast2go	binding	GO:0005488	Molecular Function	94%
Blast2go	nucleus	GO:0005634	Cellular Component	94%
Blast2go	regulation of lateral root development	GO:2000023	Biological Process	94%

Source	InterPros	Term	Type	Identity
Sma3	SNF2-related	IPR000330	-	-
Sma3		IPR000910	-	-
Sma3	Chromo domain/shadow	IPR000953	-	-
Sma3	SANT/Myb domain	IPR001005	-	-
Sma3	Helicase, C-terminal	IPR001650	-	-
Sma3	Zinc finger, RING-type	IPR001841	-	-
Sma3	Zinc finger, PHD-type	IPR001965	-	-
Sma3	DNA/RNA helicase, ATP-dependent, DEAH-box type, conserved site	IPR002464	-	-
Sma3	Immunoglobulin/major histocompatibility complex, conserved site	IPR003006	-	-
Sma3	Rubredoxin-type fold	IPR004039	-	-
Sma3	HSA	IPR006562	-	-
Sma3	Domain of unknown function DUF1086	IPR009462	-	-
Sma3	Domain of unknown function DUF1087	IPR009463	-	-
Sma3		IPR012287	-	-
Sma3	Helicase, superfamily 1/2, ATP-binding domain	IPR014001	-	-
Sma3	Helicase/SANT-associated, DNA binding	IPR014012	-	-
Sma3		IPR014021	-	-
Sma3		IPR014778	-	-
Sma3	ATPase, nucleosome remodelling ISWI, HAND domain	IPR015194	-	-
Sma3	SLIDE domain	IPR015195	-	-
Sma3	DNA ligase, ATP-dependent, conserved site	IPR016059	-	-
Sma3	Myb-like domain	IPR017877	-	-
Sma3	SANT domain	IPR017884	-	-
Sma3	Zinc finger, RING-type, conserved site	IPR017907	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: D5AD70

Fln msg: Distance to subject end: 82 aas, your sequence is shorter than subject: 91 - 377

Fln protein: MGGINLATADTVIIYDSDWNPHADLQAMARAHRLGQTNKVMIFRLVNRGTIDERMMQLTKKKMILEHLVVGRLKTQTGLNQEELDDILRYG

Protein Length: 92

Fln nts: ATGGGGGGGATCAACCTGGCCACCGCAGATACTGTTATAATATATGACAGTGACTGGAATCCACATGCAGATTTGCAGGCAATGGCTAGGGCTCATCGCCTTGGACAGACCAATAAGGTGATGATTTTCAGGCTTGTTAATAGGGGAACTATTGATGAGCGAATGATGCAGCTGACAAAGAAGAAAATGATTCTTGAGCACCTTGTTGTTGGTCGTCTGAAAACTCAAACAGGCCTCAATCAGGAAGAGTTAGATGATATCTTGCGGTATGGAG

Fln Alignment:

biogeco2_mira_c14719___GINLATADTVIIYDSDWNPHADLQAMARAHRLGQTNKVMIFRLVNRGTIDERMMQLTKKKMILEHLVV
D5AD70__________________GINLTAADTCIIYDSDWNPQMDLQAMDRCHRIGQTKPVHVYRLCTSHSAECRMLKVAFDKLKLERVVI

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain