UniGene Name: biog2_v2.0_unigene15704
Length: 162 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >biog2_v2.0_unigene15704
G |
Ace file of the UniGene biog2_v2.0_unigene15704 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene3517 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | cysteine-rich receptor-like protein kinase 6 [Arabidopsis thaliana] sp|Q9C5S9.1|CRK6_ARATH RecName: Full=Cysteine-rich receptor-like protein kinase 6; Short=Cysteine-rich RLK6; AltName: Full=Receptor-like protein kinase 5; Flags: Precursor gb|AAK28316.1|A | - | - | 0.0 | 58% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 79% |
| Blast2go | protein | - | - | 0.0 | 72% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Transferases, Transferring phosphorous-containing groups, Protein-serine/threonine kinases. | EC:2.7.11.- | - | 0.0 | 72% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | 72% |
| Blast2go | ATP binding | GO:0005524 | Molecular Function | 0.0 | 72% |
| Blast2go | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | 72% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NQB9
Fln msg: Distance to subject end: 203 aas, your sequence is shorter than subject: 53 - 290
Fln protein:
Y
Protein Length:
54
Fln nts:
G
Fln Alignment:
biogeco2_mira_c13163___YMPNNSLDKILFDPERCRILDWQKRYNIILGVARGLLYLHEDSQPRIIHRDIK
A9NQB9__________________YLPNKSLDKLLFNPERRKVLDWQKRYNIIIGVARGLLYLHQDSQLRIIHRDVK

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)