UniGene Name: biog2_v2.0_unigene15500
Length: 139 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >biog2_v2.0_unigene15500
G |
Ace file of the UniGene biog2_v2.0_unigene15500 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene20780 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | [O] COG0464 ATPases of the AAA+ class | - | - | 0.0 | 46% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 93% |
| Blast2go | protein | - | - | 0.0 | 83% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Nucleoside-triphosphatase. | EC:3.6.1.15 | - | 0.0 | 83% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Purine metabolism | 00230 | 0.0 | 83% | |
| Blast2go | Thiamine metabolism | 00730 | 0.0 | 83% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 83% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | 83% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AE60
Fln msg: Overlapping hits, possible frame ERROR between 47 and 41, Distance to subject end: 192 aas, your sequence is shorter than subject: 46 - 388
Fln protein:
V
Protein Length:
47
Fln nts:
G
Fln Alignment:
biogeco2_mira_c12919___VANLMSKWFGDSQxxVTAVFTLAQKLQPAIIFLDEVDSFLGQRRST
D5AE60__________________VANLMSKWFGDSQxxVTAVFTLAQKLQPAIIFLDEVDSFLGQRRSS

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)