SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: biogeco2 v2.0

UniGene Name: biog2_v2.0_unigene8080

Length: 248 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>biog2_v2.0_unigene8080
GGGATTTCAATGACCCAGATAGCAACTTTTGTATCTTTTTGCTAAGCACACGGGCTGGTGGTCTTGGAATCAATCTTACTGCTGCAGACACTTGTATTATCTATGATAGTGATTGGAATCCTCAAATGGATATGCAAGCTATGGATCGATGCCACAGGATTGGACAAACACGACCTGTACATGTTTACAGGCTTATCACAGCACACTCTGTGGAGGGTCGCATGCTTAAAGTAGCGTTTGGTAAGTTA

Ace file of the UniGene biog2_v2.0_unigene8080 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
SustainPine v2.0	sp_v2.0_unigene2926	4/4

Source	Descriptions	Term	Type	Identity
AutoFact	chromatin remodeling factor DDM1a [Oryza sativa Japonica Group] dbj\|BAF34944.1\| chromatin remodeling factor DDM1a [Oryza sativa Japonica Group] gb\|EEE69802.1\| hypothetical protein OsJ_29535 [Oryza sativa Japonica Group]	-	-	65%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	87%
Blast2go	chromatin remodeling complex subunit	-	-	77%

Source	GOs	Term	Type	Identity
Blast2go	methylation-dependent chromatin silencing	GO:0006346	Biological Process	77%
Blast2go	negative regulation of histone H4 acetylation	GO:0090241	Biological Process	77%
Blast2go	maintenance of chromatin silencing	GO:0006344	Biological Process	77%
Blast2go	DNA mediated transformation	GO:0009294	Biological Process	77%
Blast2go	regulation of DNA methylation	GO:0044030	Biological Process	77%
Blast2go	regulation of gene expression by genetic imprinting	GO:0006349	Biological Process	77%
Blast2go	ATP catabolic process	GO:0006200	Biological Process	77%
Blast2go	transposition, RNA-mediated	GO:0032197	Biological Process	77%
Blast2go	positive regulation of histone H3-K9 methylation	GO:0051574	Biological Process	77%
Blast2go	protein binding	GO:0005515	Molecular Function	77%
Blast2go	DNA binding	GO:0003677	Molecular Function	77%
Blast2go	ATP-dependent DNA helicase activity	GO:0004003	Molecular Function	77%
Blast2go	ATP binding	GO:0005524	Molecular Function	77%
Blast2go	nucleosome	GO:0000786	Cellular Component	77%

Source	InterPros	Term	Type	Identity
Sma3	SNF2-related	IPR000330	-	-
Sma3	Chromo domain/shadow	IPR000953	-	-
Sma3	SANT/Myb domain	IPR001005	-	-
Sma3	Bromodomain	IPR001487	-	-
Sma3	Helicase, C-terminal	IPR001650	-	-
Sma3	Zinc finger, PHD-type	IPR001965	-	-
Sma3	HSA	IPR006562	-	-
Sma3		IPR012287	-	-
Sma3	Helicase, superfamily 1/2, ATP-binding domain	IPR014001	-	-
Sma3	Helicase/SANT-associated, DNA binding	IPR014012	-	-
Sma3		IPR014021	-	-
Sma3	Glutamine-Leucine-Glutamine, QLQ	IPR014978	-	-
Sma3	ATPase, nucleosome remodelling ISWI, HAND domain	IPR015194	-	-
Sma3	SLIDE domain	IPR015195	-	-
Sma3	DNA ligase, ATP-dependent, conserved site	IPR016059	-	-
Sma3	Aldehyde dehydrogenase, conserved site	IPR016160	-	-
Sma3	Myb-like domain	IPR017877	-	-
Sma3	SANT domain	IPR017884	-	-
Sma3	Bromodomain, conserved site	IPR018359	-	-
Sma3	WD40 repeat, conserved site	IPR019775	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: D5AD70

Fln msg: Distance to subject end: 110 aas, your sequence is shorter than subject: 82 - 377

Fln protein: DFNDPDSNFCIFLLSTRAGGLGINLTAADTCIIYDSDWNPQMDMQAMDRCHRIGQTRPVHVYRLITAHSVEGRMLKVAFGKL

Protein Length: 83

Fln nts: GGGATTTCAATGACCCAGATAGCAACTTTTGTATCTTTTTGCTAAGCACACGGGCTGGTGGTCTTGGAATCAATCTTACTGCTGCAGACACTTGTATTATCTATGATAGTGATTGGAATCCTCAAATGGATATGCAAGCTATGGATCGATGCCACAGGATTGGACAAACACGACCTGTACATGTTTACAGGCTTATCACAGCACACTCTGTGGAGGGTCGCATGCTTAAAGTAGCGTTTGGTAAGTTA

Fln Alignment:

biogeco2_mira_c2715___DFNDPDSNFCIFLLSTRAGGLGINLTAADTCIIYDSDWNPQMDMQAMDRCHRIGQTRPVHVYRLITAHSVEGRMLKVAFGKL
D5AD70_________________DFNDPNSNLHIFLLSTRAGGLGINLTAADTCIIYDSDWNPQMDLQAMDRCHRIGQTKPVHVYRLCTSHSAECRMLKVAFDKL

SNPs (tot: 3)

Position	A %	C %	T %	Probability
91		75	25	0.996473
181		33	66	0.997452
185	66		33	0.997452

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain