SustainPineDB

Assembly Name: biogeco2 v2.0

UniGene Name: biog2_v2.0_unigene6341

Length: 286 nt

UniGene Fasta

Ace file of the UniGene biog2_v2.0_unigene6341

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
SustainPine v2.0	sp_v2.0_unigene16151	1/3
SustainPine v2.0	sp_v2.0_unigene61302	2/3

Source	Descriptions	Term	Type	Identity
AutoFact	Polyubiquitin 14 n=9 Tax=core eudicotyledons RepID=UBQ14_ARATH	-	-	100%
FL-Next	tr=Polyubiquitin; Pinus sylvestris (Scots pine).	-	-	81%
Blast2go	polyubiquitin	-	-	99%

Source	GOs	Term	Type	Identity
Blast2go	protein modification process	GO:0006464	Biological Process	99%
Blast2go	response to UV-B	GO:0010224	Biological Process	99%
Blast2go	ubiquitin-dependent protein catabolic process	GO:0006511	Biological Process	99%
Blast2go	vacuole	GO:0005773	Cellular Component	99%

Source	InterPros	Term	Type	Identity
Sma3	Ubiquitin	IPR000626	-	-
Sma3	Ribosomal protein L40e	IPR001975	-	-
Sma3	Ribosomal protein S27a	IPR002906	-	-

Full-Lengther Next Prediction

Fln status: Putative Complete

Fln database: coniferopsida.fasta

Fln subject: Q41067

Fln msg: ERROR#3, very serious frame error, warning!, putative chimeric sequence! or repetitive structureatg_distance in limit (1-15): atg_distance = 16, Unexpected STOP codon in 5 prime region, your sequence is shorter than subject: 160 - 761

Fln protein: EAQTPIDNVKAKIQDKEVFPPDQQRLIFAGKQLEDGRTLADYNIKRNPPCTLCSV*EVACRYLLKPSLGRQ*RWKLRAPTPLTTLRPRSRTRKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHPAPCAPSERWHADIC*

Protein Length: 161

Fln nts: GAGTGAGAAGCTCAGACACCTATTGACAATGTTAAGGCCAAGATCCAGGACAAGGAGGTATTCCCACCTGATCAGCAGCGTCTGATCTTTGCTGGAAAGCAGCTCGAAGATGGTCGAACACTTGCGGACTACAATATCAAAAGGAATCCACCCTGCACCTTGTGCTCCGTCTGAGAGGTGGCATGCAGATATTTGTTAAAACCCTCACTGGGAAGACAATAACGTTGGAAGTTGAGAGCTCCGACACCATTGACAACGTTAAGGCCAAGATCCAGGACAAGGAAGGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTCCACCCTGCACCTTGTGCTCCGTCTGAGAGGTGGCATGCAGATATTTGTTAAAACCCTCACTGGGAAGACAATAACGTTGGAAGTTGAGAGCTCCGACACCATTGACAACGTTAAGGCCAAGATCCAGGACAAGGAAGG

Fln Alignment:

Contig6341___xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Q41067_________________xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SNPs (tot: 8)

Position	A %	C %	G %	T %	Probability
73		33		66	0.997452
122	75	25			0.996473
128		25	75		0.996473
140		25		50	0.995533
141	25	75			0.996473
145	75		25		0.996473
156		75		25	0.996473
182		25		75	0.996473

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain