SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: biogeco2 v2.0

UniGene Name: biog2_v2.0_unigene372

Length: 453 nt

UniGene Fasta

>biog2_v2.0_unigene372
AACCATTAGGAAGGCTGATCTGGTGGCAGTTGTTCAGCAGGGGAGCATTTTGGAGATGGGGACTCACGATGACCTTATCTCAAAAGGGGATGACGGGGCTTATTCAACATTGATCAGACTCCAAGAAACTGCCCATGAGCTTGGTAACAATGCAAGAAAGAGCAGTGCCAGGCCCTCCAGCGCAAGGAATTCTGTGAGCTCGCCTATAATTGGAAGAAATTCTTCTTATGGCCGATCTCCCTATTCCAAAAGGCTTTCAGACTTCTCAAATTCCGATTTCAGCGCATCTGTCGATGTCAACTCAGCACACAAAGCAGAGAAAGTACCCTTCATAGAGCAGGCAGGGTCATTCTGGAGACTAGTCAAGATGAATGCCCCAGAATGGGCCTATGCCCTACTAGGATCCGTAGGGTCCATGGTCTGCGGTTCCATAAGCGCACTCTTCGCTTACAT

Ace file of the UniGene biog2_v2.0_unigene372

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
SustainPine v2.0	sp_v2.0_unigene10393	2/2

Source	Descriptions	Term	Type	Identity
AutoFact	Multidrug/pheromone exporter, MDR family, ABC transporter family n=2 Tax=Malpighiales RepID=B9IFR5_POPTR	-	-	65%
FL-Next	tr=MDR-like ABC transporter; Taxus cuspidata (Japanese yew).	-	-	58%
Blast2go	abc transporter b family member 1-like	-	-	85%

Source	ECs	Term	Type	e value	Identity
Blast2go		EC:3.6.3.3-	-	0.0	85%
Blast2go	Xenobiotic-transporting ATPase.	EC:3.6.3.44	-	0.0	85%

Source	GOs	Term	Type	Identity
Blast2go	positive gravitropism	GO:0009958	Biological Process	85%
Blast2go	response to nematode	GO:0009624	Biological Process	85%
Blast2go	anthocyanin accumulation in tissues in response to UV light	GO:0043481	Biological Process	85%
Blast2go	photomorphogenesis	GO:0009640	Biological Process	85%
Blast2go	regulation of cell size	GO:0008361	Biological Process	85%
Blast2go	response to blue light	GO:0009637	Biological Process	85%
Blast2go	auxin efflux	GO:0010315	Biological Process	85%
Blast2go	auxin polar transport	GO:0009926	Biological Process	85%
Blast2go	transmembrane transport	GO:0055085	Biological Process	85%
Blast2go	ATP catabolic process	GO:0006200	Biological Process	85%
Blast2go	stamen development	GO:0048443	Biological Process	85%
Blast2go	ferric-transporting ATPase activity	GO:0015408	Molecular Function	85%
Blast2go	auxin efflux transmembrane transporter activity	GO:0010329	Molecular Function	85%
Blast2go	xenobiotic-transporting ATPase activity	GO:0008559	Molecular Function	85%
Blast2go	calmodulin binding	GO:0005516	Molecular Function	85%
Blast2go	ATP binding	GO:0005524	Molecular Function	85%
Blast2go	integral to membrane	GO:0016021	Cellular Component	85%
Blast2go	plasma membrane	GO:0005886	Cellular Component	85%

Source	InterPros	Term	Type	Identity
Sma3	Peptidase, cysteine peptidase active site	IPR000169	-	-
Sma3	ABC transporter, transmembrane domain	IPR001140	-	-
Sma3	F-box domain, cyclin-like	IPR001810	-	-
Sma3	Ribosomal protein L10, eubacterial, conserved site	IPR002363	-	-
Sma3	ABC transporter-like	IPR003439	-	-
Sma3	AAA+ ATPase domain	IPR003593	-	-
Sma3	Vacuolar fusion protein MON1	IPR004353	-	-
Sma3	Phosphopantetheine attachment site	IPR006162	-	-
Sma3	Inorganic pyrophosphatase	IPR008162	-	-
Sma3	Leucine-rich repeat 2	IPR013101	-	-
Sma3		IPR013596	-	-
Sma3	ABC transporter, conserved site	IPR017871	-	-
Sma3	ABC transporter, integral membrane type 1	IPR017940	-	-
Sma3	Cytochrome P450, conserved site	IPR017972	-	-
Sma3	HTH domain AraC-type, conserved site	IPR018062	-	-
Sma3	Peroxidases heam-ligand binding site	IPR019793	-	-

Full-Lengther Next Prediction

Fln status: Putative C-terminus

Fln database: coniferopsida.fasta

Fln subject: E6Y0T0

Fln msg: STOP codon was not found. Distance to subject end: 107 aas, your sequence is shorter than subject: 150 - 1316

Fln protein: TIRKADLVAVVQQGSILEMGTHDDLISKGDDGAYSTLIRLQETAHELGNNARKSSARPSSARNSVSSPIIGRNSSYGRSPYSKRLSDFSNSDFSASVDVNSAHKAEKVPFIEQAGSFWRLVKMNAPEWAYALLGSVGSMVCGSISALFAY

Protein Length: 151

Fln nts: AACCATTAGGAAGGCTGATCTGGTGGCAGTTGTTCAGCAGGGGAGCATTTTGGAGATGGGGACTCACGATGACCTTATCTCAAAAGGGGATGACGGGGCTTATTCAACATTGATCAGACTCCAAGAAACTGCCCATGAGCTTGGTAACAATGCAAGAAAGAGCAGTGCCAGGCCCTCCAGCGCAAGGAATTCTGTGAGCTCGCCTATAATTGGAAGAAATTCTTCTTATGGCCGATCTCCCTATTCCAAAAGGCTTTCAGACTTCTCAAATTCCGATTTCAGCGCATCTGTCGATGTCAACTCAGCACACAAAGCAGAGAAAGTACCCTTCATAGAGCAGGCAGGGTCATTCTGGAGACTAGTCAAGATGAATGCCCCAGAATGGGCCTATGCCCTACTAGGATCCGTAGGGTCCATGGTCTGCGGTTCCATAAGCGCACTCTTCGCTTACAT

Fln Alignment:

Contig372___TIRKADLVAVVQQGSILEMGTHDDLISKGDDGAYSTLIRLQET
E6Y0T0________________TVRNADMIAVVQRGSIVEKGSHSQLIT-NPSGAYSQLIHLQES

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain